Observation Akullaspatiale

anak mana?

2010-06-05T00:58:00.001+07:00

SMAK 1

Termehek-mehek

2010-05-31T20:25:00.000+07:00

Gila, 15 taun gue hidup kayak gini. Kagak pake mikir, SKSD, sok baik, sok - sokan lah. Pandangan gue ke hidup juga rendah, curigaan, penuh kepalsuan. Lebay, dangkal, bego, lemot, dan terpengaruh sama orang lain begitu gampangnya, biasanya yang jahat. Masa depan gue dibentuk sama imajinasi gue yang liar dan gak terkontrol. Paranoid berlebihan yang ngejauhin diri gue dari temen- temen gue sendiri. Gak ada semangat hidup bikin gue males belajar, merasa pinter, sombong.

Gue mau mulai awal yang baru. Gue pengen bikin pribadi baru. Tapi bisa gak gue berubah kalo gue gak dapet bantuan dari orang sekitar gue? Gue bakal berusaha.

Oh Man, My First Copy - Paste Post. Enjoy.

2010-05-10T22:33:00.002+07:00

There For You
By : Flyleaf
Sometimes I'm a selfish fake
You're always a true friend
And I don't deserve you
'Cause I'm not there for you
Please forgive me again

I wanna be there for you
someone you can come to
runs deeper than my bones
I wanna be there for you
I wanna be there for you

Swirling shades of blue
Slow dancing in your eyes
The sun kisses the earth
And I hush my urge to cry

I wanna be there for you
someone you can come to
runs deeper than my bones
I wanna be there for you
I wanna be there for you

'cause I hear the whispered words
In your masterpiece beautiful
You speak the unspeakable through
I love you too

I wanna be there for you
And be someone you can come to

I wanna be there for you
And be someone you can come to
The love runs deeper than my bones
I wanna be there for you

formspring.me

2010-03-29T20:38:00.001+07:00

Ask me anything http://formspring.me/kevinreiner

formspring.me

2010-03-29T20:37:00.001+07:00

Ask me anything http://formspring.me/kevinreiner

Phototrace

2010-03-27T23:10:00.001+07:00

Hi guys. This place has become so silent, outdated, and still, creepy. Damn, I guess I put it into hiatus and did not realise it.

Ok, I'll find a reason. How about this, I'm busy because I'm working on something good...

But actually, I do.

TADA

Phototrace.

It's still far away from finished...

Got her from this photo.

That's what we called phototracing. It started as a New Year present for my classmates.

It's just OK, and I'm improving.

Some were good, and some were bad. Quality depends on the photo. Guess where I am.

But another example I've got from the internet shows that I am still nothing.

This one is absolutely nice... and fiery :p

A calming pic after that one. :D

BUT LOOK!
NOW THESE ARE AMAZING!

Man, suddenly I just felt like a dwarf...
Gotta get out of this damn Ninja Saga and start working.

This blog is back into indefinite hiatus.
Bye.
__________________________________________________________________________________

2010-03-24T23:28:00.002+07:00

:''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''(

gone.

Huzzah!

2010-01-24T00:53:00.000+07:00

I am rather obsessed with physical strength, physical exercises, and sadly, physics. (Call me a geek, I had no choice. Except if sitting in grade 10 for two years could be considered a choice. Bad choice.) Once begins, you'll do it again and again, at least until fatigue hits you.

Looking into my past, I've been always considered one of the weaklings - in fact, I might be the weakest man in wherever place I enter, even my girl friends would maul me in less than a minute in an armwrestling. I can't even land a kick or made anyone suck a single fist.

Even karate did not change that at first.

After spending a year or two bathing my head with fighting how - tos, plus a bucket of brute strength I always burst in a kumite (sparring), I still ended up with losing. This annoys me, and I wonder whether my biceps sucks and had to be changed with a dozer's hydraulic. At the end, I realised that I'm a total loser, and start filling my days with suicidal activities. This results in my own death in 02th January 2010. This is fake, ignore after reading.

After spending a year or two bathing my head with fighting how - tos, plus a bucket of brute strength I always burst in a kumite (sparring), I still ended up with losing. This annoyed me, and I wonder whether my biceps sucks and had to be changed with a dozer's hydraulic. At the end, which is several months ago, I realised that I've been tricked by every single man on the earth, playing me and putting me into their game.

I'm temperamental. Temper means losing to everyone, losing to yourself, losing friends, losing your own life and dragged into everyone's exact will, and losing your money in a street fight.

***

In my room, I remembered what we say everytime we practise together : Karate's Creed.

1. Able to keep personality.

2. Obey to Honesty.

3. Able to achieve.

4. Able to be polite.

5. Able to control myself.

All this time, I did none of them. Especially the number five.

Knowing that my only flaw is my own ego, I improved myself. In addition to my physical endurance, I added up speed and patience into my hands. They won't play me anymore like a cloth doll.

I will play my own f*****g life. HUZZAH!

Hey, wait, that ***** stands for fishing. Really.

That's all for today, bud. Make friends, not biceps and bruises. Check another time for another nice shit you won't found in the stores, and have a nice day.

Ciao,

Manh Xa - Khaia

Enggris Please, For All Satanic Things

2010-01-10T14:57:00.001+07:00

Humans, ourselves said, are the most intelligent living being in the known universe, or at least the known Earth. Looking (figuring, I should say - only a part of our history were written. The rest are mounds of boney earth, enriched with Carbon - 14 isotope) to our past, the first appearance of Homo sapiens, our kind, could be dated back to 200,000 years ago. What a bunch of old wise men we are.

Speaking about intelligence, I suddenly pulled something buried beneath ashes, broken fridge. Intelligence... what it says... it's something "ability to reason..." "use language..." whatever. Search Wiki. F.Y.I, a Language is is a particular kind of system for encoding and decoding info. (Straight from my Encyclopedia)

Speaking about language...

Oh please stop use "speeking about" I tired it is bored. Enggris please?

No, I created it myself. No - one is foolish enough to write that broken Enggeris, in my age.

But I wonder whether this has correlation with person's character and culture. Yes, the language. It seems to me that language depicts its users. Here are some examples :

Brit. Engl : Taking every latin - based languages' vocabs.

Users : Taking over the world on the past, leaving Commonwealth Nations scattered over the world.

Ame. Engl : Fast and distinct.

Users : Slow coach potatoes and indifferent.

Indonesian : So simple yet confusing.

Users : Applies for the girls.

Malaysian : Quite odd.

Users : Very odd.

Japanese : Writing pictures.

Users : Producing (nude) pictures.

Arabic : Write from right to left, fighting the stream.

Users : Currently fighting the world, and are always right.

(Just kidding. The list above are modified form of common stereotypes which could be found everywhere.)

Seriously, our language shows our inner self and intelligence. A person able to speak a lot of languages are quite rare. Since I use three, you can call me...

Just forget it. My Hanyu's terrible.
Make penfriends, not friend pens.

Ciao,
Manh Xa - Khaia

Bananas

2010-01-08T22:14:00.000+07:00

It is said that a lot of people found their inspiration inside the bathroom. It works well on me, public restroom in my case. While taking a poo, I decided to write about it, complete with my experience.

Every few hours, a contraption consisting of 70% water, 20% carbon, 8% minerals, 1% poisonous thingies (artificial colouring, sweetener, formaldehyde, borax, Rhodamin B, etc) and 1% friendship, namely human body, dumps several hundred grams of chemicals called poop AKA banana AKA muffin.

These are bananas...

And this is a muffin.

The poo itself is not much a problem, despite the stink; the main problem comes when quantity increases while decreasing output's quality.

OOOOH SHIT!

No, mine was not that bad. It was still solid, solid enough to drop straight the hell hole... and the resulting splash breached the water closet's borders. I had to take a bath after - can't sacrifice my family's health. But it's still exhausting - sometimes it just went wrong and stuck inside, requiring extra power. Five times a day. Dare to beat my score?

Of course, I can take medications to stop the natural plumbing system. The only problem is that the medicine ceased it too perfectly the last time I used it. So perfect that I felt like a black hole - what comes in doesn't come out. Great outer space experience for three days, I should say.

Of course, my mother was curious.
"Kevin, when did the last time you had a poo?"
"Don't even remember. Maybe before you gave that chemical tablet thingies?"

My mother stopped the prescription.

Soon after the medicine subsided, the Black Hole collapsed into another hole called WC. The moment after, suddenly, the second Universe was created, along with Big Bang. Millions of bacteria entered this new world to do decomposing, eating, and conquering my septic tank's contents.

After all those (literal) shit, I went to the fridge and pulled out loads of healthy, juicy, fibrous tropical fruits from it, and ate them all. Hope that won't happen again.

Make up your mind and yell out something great, not something crap (like this story of course)

Ciao,
Manh Xa - Khaia

Explosive

2010-01-04T20:56:00.001+07:00

Tired with your life? Wanna get famous now and die one hour later? Wanna get Blue Whale on Twitter? Then you've come to the right place! Just tweet some bad jokes from MANH & CO and be famous! Favourite quotations including:

"Every BlackBerry user is Alay" by Rana Auliani;

"What Goes Around Comes Around" by Justin Timberlake; and

"The quick brown fox jumps over the lazy dog" by... um... just forget it.

Remember, with a LOW, LOW cost of being confronted by the whole nation. What are you waiting for? Be famous. Be cool.

That was the <sarcasm> best </sarcasm> ad ever. That will surely flame the whole Indonesia, at least areas which had been infected by Twitter, or Alays, or BlackBerry. Any of them.

I wonder,if I ignited a match in a room full of BlackBerry users, would they burn?
We should be ashamed to ourselves - where is our self control? Where is our so - called hospitality?

:@ :@ :@ :@ :@

We look like a pack of chirping (or tweeting, maybe) monsters now. What the world will say?

Make friends, not trending topics.

Ciao,
Manh Xa - Khaia

2010

2010-01-04T13:00:00.000+07:00

"HAPPY NEW YEAR EVERYONE!"

Oh, no, I'm not really that enthusiastic. Especially because I'm sure I'll keep myself zolo. Means solo. Means 2010.

However flat these days are, at least I'll be back to school. (After waking up from a long dream of being an alien, 1th January wasn't very useful at all - I'm still sleepy. Literally, after get to bed late for... 2 weeks? I'm not sure.) Never, never in my life before (exception for EF and AIR - and both are too late, when I realised what are friends) I want to talk with them. They are not strangers anymore, not after I opened my cloak.

The entire school have to wait, though.

-_-_-_-_-_-

While I'm desperate for company, the others are craving for them. They hate people, but they need them to exist. After all, they have given all their life - even their secrets, lies, tears - for public consumption.

Celebrities. Let's get off the topic a bit.

:s :s :s :s :s

Basically, there are three types of energy in this world : Kinetic, Potential, and (Money). And celebrities had a lot of the lattest. Lots. Lots and lots. And lots are always dangerous, especially parking lot, if you have Aston Martin Vanquish. Their (Money) energy often reaches dangerous levels that might do harm to them, like narcotics, divorce, and a dress which is too long and make them fall from the 8th floor. And remember the Law of Energy :

"Energy under normal conditions cannot be created or destroyed, simply transformed from one type of energy to another."

- Anonymous Genious

Of course, this is their approach for a new year : new Hot News. And they will spend their (Money) energy for fame, more money, and Louis Vuitton.

Of course, everyone wants to be like them - so most everyone try to do what they do. Wasting money. Artificial beauty. Famous kids. The teen world suddenly separated with a fissure, differs Exist gals and guys with those under. Alays are not included.

Another possibilities that burns (Money) energy while increasing your fame including :

- Go for a professional makeover and ask for a Special Packet including :

> Creambath

> Blow

> Trend - setter haircut

> Comfy seat

> Makarizo

> Scissors that does not hurt

> Handsome plastic face (Wait. Only some can afford this.)

> etc. (I ran out of ideas)

- Make a party all night all day with either your money, or your parents'.

- Sex scandal video (Million bucks to shut their mouth...)

- B.A.S.E jumping without a parachute (cancel your insurance before).

- Fame - seeking based charity (Real celebs only. Not for Exist teens).

- Holiday in Japan - make sure to use Yen for a maximum impact on your balance sheet.

- Holiday in Bangka - in a rainy day, with thunders that picks everything, even ground - level buildings.

- Holiday in Bermuda Triangle - your family will do the job by spending your money to find you.

And other crazy things just like last year.

:-| :-| :-| :-| :-|

Can you see what's the problem now? I'm fed up with them. They are part of New Year's fake happiness, entertaining fools, entertained fouls, everything which is nothing. Can't we just change? Why wait for a new year? I made the New Year change by changing my attitude to my friends, and what I think about them.

But I can't stand the people. Hedonists, I should say, for they only accept happiness. Faux felicita. False happiness.

I'm sorry. I don't know what to do with this nation. My nation.

This is 2010 man. Make changes, not debts.

Ciao,

Manh Xa - Khaia

An Article 4b0uT UpZ EeNd D0wNNzzZ,,,,,,, (Man I Almost Killed Myself Typing That)

2009-12-29T17:10:00.002+07:00

"1iFe eEz nEveR Fl4T,,,,"

- anonymous on the reason why they write like this

Often used by "alay" in Indonesia, informal writings like this are the side - effect of handphones, ten fingers, and the Shift key. Most normal person who read leeted text are often confused, irritated, or even exploded. I resisted, so hail me now. thank God.

This is just another reason to Visit Indonesia - great waves are available outside Bali.

Why people like to write like this?
My Extensive - and - What a Waste of Time - Experiment (EWW TEXT) for a lifetime gives some reasons why :

1. If you notice Candybar or Clamshell phones which didn't use QWERTY keyboard, it's necessary to press a key several times JUST TO TYPE A F@CK!NG NUMBER ONE (1). It is also needed to type short - only 160 characters allowed here, man.

Time after time, the user's hands become used with this kind of situation, making their fingers extremely agile. They even become able to manoeuvre between text menus and symbols, and soon they began stocking up on shorten vocabulary lists. They also found it's fun playing with capitalize button. Even when they finally use a better phone, they keep their style.

2. Leftover theory. Trend changes everyday without notice. When gaulistas (cool peoples) can catch up with the stream, some people can't. What they know today is what we know yesterday. If we look into our past, when BlackBerry doesn't exist, we often do the point mentioned above. Meanwhile, they haven't got any cellphones. Years passed, and we adopted a new trend. Considering it cool, they adopted our former trend. Including our writing style.
And we hate them for that.

Special thanks to this guy.

3. Chat and foreign pop culture. Leet / 1337 is a style of writing in which the standard character of English is substituted with another ASCII character, pretty similiar with bumpy text we're discussing here.

4. Speed bumps (polisi tidur). They also made the writings bUmPy.

5. Chitato. They are extremely wavy.

"...."

"Manh...."

OK, the last two are stupid :D

:P :P :P :P :P

However annoying these texts are, we shouldn't judge the users as alay. After all, lots of humans are judging upon another based on their style. This is unfair, as everyone got their own, or stole it for their own. We should look at their behaviour instead. Is Andika Kangen Band alay? Or a fellow who participated in a street fight, just to make himself cool?

Do what's good for you and the world, man. Make friends, not babies.

Ciao,
Manh Xa - Khaia

Ho - Ho - Ho!

2009-12-25T23:40:00.003+07:00

WARNING

Language rating : PG – 14.

First of all...

Merry Christmas, my friends, along with everyone who wants Him!

And everyone who just want to be happy. C'mon, this ain't a God matter. This is snow.

***PRIVATE AND CONFIDENTIAL***

As soon as you finish reading this, check your chimneys because I want it opened. Don't make my butts stuck there, along with black, black ashes.

***DISPOSE AFTER READING***

I'm posting from Pangkalpinang right now, where the internet is as slow as snail – not to mention Zimbabwean. Yes, I'm having a two – week holiday with my Father, my father (Confused? See Trinity !), my Granny and Granpy, porks, hogs, frogs, more frogs, and hundreds of Aedes aegypti which keeps searching and keeps sucking my dick blood.

So far I haven't got any fever. So please pray for me so I won't.

Here at my Granpy's house, Christmas celebration made everyone happy, proven by my early rose at 7.00 AM – from the usual 11.00 AM. Even my Granny took a rest from her daily bread : cooking, cooking, and cooking. However, several things don't cease : her rambling, deafness, and so on. She also keeps telling us to eat whenever she remembers – in a three hours interval.

Sometimes, I regret stealing food from the table an hour before.

Oh! I have something to share. Do you still remember this post? Yes, now animated version is available! Take a look. Long look. Forever. I love this picture. One, it is nice and detailed. Two, the girls' are cute. Three, I'm handsome.

Just kidding. It's because I know we're always in each other's heart

♥ (ooooooh) ♥

From left to right : Angga, Amira, Vania, Brena, Dhini, Risa, me

Made by : Nilam 'pwns' Sari (http://nilampwns.tumblr.com)

Ouch! You've been pwned. Get off before you're owned.

NOTE : She doesn't draw herself. If only I could draw...

Did you know? This reminds me of my terrible attempt to “draw” us, several months ago. I feel pwned. Oh Nilam, you really pwns.

See? I'm multi – UNtalented. The only thing that saves my face (the real one, not the one in the drawing) is that these 'drawings' were used as the title's decor, so everyone considers it's the best WE can do were refined with black marker, thanks to them. You can see the result below.

I'm pretty sure one of them will kill me. Or maybe they'll arrange a tac – team.

From left to right : pretty clear.

Made by : Me (Kevin Reiner)

Once again, Nilam wasn't here. Somehow she hates being depicted. Actually I DO draw her, if a drawing of someone covering one's face counts as a drawing.

♥ ♥ ♥ ♥ ♥

And now, she inspires me to do something again. It's kinda secret, and this is a personal matter which we won't discuss now.

While we're swimming in the Sea Of Happiness, Christmas Carol, and Cinnamon Roll....

Remember 26th December, 2004.

That day, a big earthquake shook us really good, with a Tsunami came after. About 200,000 got slaughtered, with millions in hunger, plague, and most are homeless. Victims are in Aceh, Indonesia; Maldives, India, and even Africa. Until now, some are still refugees, due to the houses given were taken by some bastard idiot noobs people who took advantage with these easy housing.

Let's pray, mourn, remember, or whatever you consider the best for a moment.

We cannot weep our past forever. We also have to look forward, into the future.

☠ ☠ ☠ ☠ ☠

PREPARE FOR THE 2010 MAN!

Yes, 2010, with only 2 digits lower that the awesome 2012, is coming. The last 6 days (counting from 25, it's 25 here) of 2009 is a moment of hope, a moment of reborn. A moment for change. Change we need.

”Obama? Is that you?”

“No, it's not me.”

However, some sceptics helped us by keep telling us about the stale ceremony people keep celebrating each year, which is just the same (Hats, trumpets, Barbeque, greeting cards, and be there credit cards to pay 'em) about we only change a little, if not nothing at all. Agreed. Remember that the most important thing of a changing year is the changing human, not the year itself. Not the concert at the beach. And not the calendar. (After all, I'll miss that Pierre Cardin promotional calendar that my mother got for this year. It supplies you every month – EVERY MONTH - with hot chicks with two – piece bikinis Damned pervert brain. -___- )

♂ ♂ ♂ ♂ ♂

Oh man, I run out of topics here. So I guess that's all... For this year.

Good luck my man.

***CLOSE BUTTON READY***

***CLICK WHEN READY***

poetry |ˈpōətrē; ˈpōitrē|

2009-12-08T21:39:00.004+07:00

noun

literary work in which special intensity is given to the expression of feelings and ideas by the use of distinctive style and rhythm; poems collectively or as a genre of literature : he is chiefly famous for his love poetry.

• a quality of beauty and intensity of emotion regarded as characteristic of poems : poetry and fire are nicely balanced in the music.

• something regarded as comparable to poetry in its beauty : the music department is housed in a building that is pure poetry.

ORIGIN late Middle English : from medieval Latin poetria, from Latinpoeta ‘poet.’ In early use the word sometimes referred to creative literature in general.

I have realized since long that my lazy brain likes dreaming, wondering... without any point at all. Without some intelligence to control it, the result would be catastrophic. As the result, I put all those things my brain tries to claim as its product, when it's only cliche things happened in my life.

Like this.

Bedebah

Today at 04:12 | Edit Draft | Remove

Keringat bercucuran membasahi dahiku.

Mataku berlinang hantu yang hidup segan mati tak mau. Tercium daging yang membusuk, makin lama makin bau. Rangka yang tersisa, tulang - tulang yang tak lagi bersatu.

Ada orang berkata, segala yang buruk pasti akan tercium baunya. Deodoran sepuluh botol pun takkan mampu menyembunyikan aromanya. Kalau begitu, tinggal tunggu waktu saja sebelum orang menelanjangi kubur para pendosa.

Dan peluh menyiram cangkulku, cangkul yang menerabas batuan yang menghalangiku. Napasku makin memburu, makin nafsu. Kututup mataku, kulenyapkan ngeriku, kurangsang birahiku.

Aku mengangkat mayat itu, matanya memantulkan wajahku.

Nothing could be worse.

We Are Nightmares

2009-12-07T20:01:00.000+07:00

No, you're not you. They are.

Don't you realize, you don't really exist? You are a dream, their dream, a dream to necome something stronger, something bigger, something better. They can live alone, but they have chosen not to be alone, for a greater good. They sacrificed everything they had, just to reach their dream.

But what they dreamt is a real crap; nothing strong, nothing great, yet it enslaved them, tortured them in its effort to become real, but it always fails, until they are tired living with it, and died with it.

You are the dream; you tortured them.

Understand them, free them.

Help them, raise them as your masters.

You'll be free, 'cause they dream no more.

Quod Erat Demonstrandum

2009-12-05T12:37:00.001+07:00

Some quotations won't make me the King of Quo(te). It's the way to quench my irrational side's thirst to burst.
Ok... here we go.

[logical core center reset]

[result unknown]

[8n*C*#*!!!!!!!!!!!!!!]

!!!!!!!

lame lame this is so lame! even lamer than llamas!!
at this time, I don’t have a place to talk about nonsense craps. like I used to do at EF :’S you know when you just say things like “I met that person again!” or “I wanna be a doctor!” or maybe the most unimportant thing like “OMG I MISSED CINTA FITRI AGAIN!!!!!” normal people might only answer “apaan sih” but this is so different. we talk about crap but we’re happy.

but now when I talk about unimportant stuffs, no one replies.

taken from Nilam

[AUTOMATIC SYSTEM RECOVERY]
[status : OK]

Damn, so far I've been trying to grasp the power of logic and self - control. So far so bad -_- but that doesn't mean it's impossible.
Perhaps it's because I'm doing what I want to do, not what I have to do. Although it feels good, but it's only for a while. Responsibility is a must, but so far I rejected it... why, why.

In order to maximize our strength, we have to admit that our tendency to seek happiness is our fatal flaw, our dangerous weakness. Having it means killing ourselves.

And I'm dying.

....?

Life Is The Perception Of Your Own Reality

2009-11-22T22:33:00.001+07:00

Oh, this is what we called night, when your eyelids are screaming for heaven's sake to be shut. And a time to think, WTH have you done this day. I started thinking about my life... have I gone mature, as I always want to be, so I can end this unstable self, this selfish being?

What is mature?

Meanwhile, my hands quickly reacted, and while the Left is still on the keyboard, the Right moved into the Trackpad and started browsing hot topics... everywhere, to keep me from boredom... even perhaps an answer to my question.

Soon, I arrived in a page where all I can see is...*UNSPOKABLE*

And my skilled fingers jumped from links to another, until I arrived at http://rediscoveringatlantis.blogspot.com.

Hmm... seems interesting. I viewed the comments, searching for something useful, perhapsmy answer lies here?

My eyes caught this:

dulu kita lagi ngomongin apa saya juga lupa -_-
pokonya ka dora bilang ,
"kenapa sih kalian bisa bilang orang alay ? sebenernya kamu juga bisa dibilang sama orang
alay . jadi alay tuh menurut penglihatan kamu apa ? misalkan baju yg orang pake dan menurut kamu gaya itu alay atau lebay,tapi menurut yg pake itu keren . bisa juga kan sekarang baju yg kamu pake atau kamu ke mall pake baju ala kamu , bisa juga kan orang nganggep itu alay atau lebay . jadi setiap orang bisa mengatakan semua orang itu alay atau lebay ? bisa juga kalo kamu pake sepatu kek pake gelang pake apapun yang kamu anggap oke belom tentu diliat orang juga oke bisa juga malah dibilang alay atau lebay . "

gue tambah2in dikit sih .
bukannya mau sok tau apa sok pinter apa sok apapun
ya mungkin gue juga belom bisa berhenti mengucapkan kata alay
mungkin karena tulisannya yang
" iH k4myu koQ g1tHu C11 "
apa yang
" Ih Qm keNaPa cIh ? "
ya pake angka2 atau hurufnya besarkecil
ya sebenernya kita emang ngga nyaman bacanya . tapi mungkin itu yang mereka bilang keren .
yang mereka suka ya tulisannya kaya gitu

mungkin kita harus lebih bisa menghargai apapun .
dan kita harus menyadari setiap orang berbeda. apa yang orang suka
juga ngga sama , ada yang kita suka mereka ngga suka dan sebaliknya
jadi sih menurut gue , kita harus bisa menghargai ya kalo kita juga mau di hargai
ya mungkin ngga penting , tapi menurut gue bisa masuk akal kan -,-

I know you Indonesians do not need translations for that. And... worthy clue. Mmmm.

***

So I did a little, general intuitive analysis from that blog, with a hope to know more about this man. I read several early posts, dated back to July '09... I also have seen both pros buddies (Partydorks and sorts of) and cons guys (APWG), although some members of both group showed up sympathy to each other.

I don't know why, but in less than 5 months, the musician/blogger (Dochi Sadega) showed great advance in his posts. The way he thinks, writes, to calm down and not let his emotion take over too much. But not the people around. Only several notable individuals (example) showed maturity, proper considering and way of addresing dislike, respect, and so on. The rest are just throwing either fanatic support or hatred, without a stronger base. Someone may say "oh no, this is wrong, bla bla bla...." and they just accept whatever fits with them, "yes, yes that's right, we must do that, bla bla...." and when someone argues it the mighty word appears.

"But...."

***

Seems like they are having problem, between this and that. Music, sexuality, style, .... They argue every single thing, every single mind. And even some pretends to be neutral, some are real... some did that just to protect theirself.

To end a problem... maturity is a must. Not to mean plain logic - we need intuition and feeling to deal with those who use it solely as their guide of life. Now lemme ramble and conclude.

***

We live in our own imaginative perception, embracing us like a personal atmosphere. Inside it, we can't see something truly as is - just like stars blink and thus alters our observation, if we see it from Earth. Every single thing will be different because of our own perceptive. Thus our emotion plays here, showing up our childish attitude.

To reach maturity, we must GTHO from this toxic atmosphere. The only problem is this atmosphere is quite sturdy and hard to pass, like a barrier wall. Humans tend to pretend that they are outside the wall, even if they're inside - just to make them seems right. They tried to walk just like the barrier doesn't exist, but they stuck on it.

Then they have to admit that they are inside, with all their weakness and wrongs. It hurts, yes. The shame, the guilt, the everything, but we have to do this. So we can calm down and find a door.

And then you're free. Just like that. After the pain.

The PAIN, stultum.

Ants, They're Everywhere

2009-11-22T19:21:00.001+07:00

"They're Everywhere!"

- BOB in Bob - B - Q, UESC MARATHON

July 3, 2794 A.D

If you're a Marathon fan, you'll recognise what this phrase means. And yes, I felt the same thing this morning, as one thousand thousand creepy things invaded my house during their migration to their unknown new home, hidden between space and time.

Solenopsis saevissima richteri

Yeah... they infested every single corner, every single houseware, and even every single clothing! I took a bath this morning only to found hundreds of those damned Insectas had infested my towel... and gave me a sweet farewell gift : whole swollen chunk of skin.

My entire body turned into piggy red swellings.

Luckily I didn't use it to dry my legs.... But I had to take a bath again, with all those painful itches, just to wipe them off my body. I got late to the church, and I sat there, trying not to look at the eyes looking at me, saying, "why are you late?", and keeping my hands from getting inside my shirt, scrubbing my body.

Those damned ants. They're everywhere, can't stand 'em.

It's Strong, Are You?

2009-11-16T22:22:00.000+07:00

"There are obviously many things which we do not understand, and may never be able to."
(taken from Marathon)

The word above is a variation of a concept to justify our weakness as a human : Stultum (foolish).

For an uncertain period of its civilization span, humans have never truly reached the agreement about their point of life; why we are here, why we were put in the Earth rather than Tau Ceti, why we prefer dealing with our Macs rather than hunting for food and knowledge.

The last statement came from me. :D

Humans try to answer, but they never reached a point where their two ideas met.
It is the battle of Intuition and Logic. Not between man and women - women can get strong if only they are willing to let go their primitive nature of intuition (which is useless to say, since everyone believes it's their nature - but it isn't, it's patriarchal society - made.)

The Big Battle between The Faithful (religions, mystics, intuitives) and The Naturalist (scientists, sceptics, logics) has been started since people start knowing - I wonder why. However, I found something metaphorical to picture this - the famous Knowledge Tree, which fruit Adam ate.
For those who don't know about this, Humans begin their finite life when Adam ate the fruit which gave him Knowledge - that's why it's the Tree of Knowledge. We can conclude like this :

Know, and you're die.
Keep foolish, and you're safe.

But is it true?

Which of those two are better?

Anyway... I found some clues.

1st Answer : http://www.skepdic.com/ . It's a guide to critical thinking. To us it seems dangerous, and most will feel uneasy with this, since this site's views about supranatural things (and religions) are quite sceptical.

But we FEEL. We can't trust and rely on just our feelings, can we? All our senses can lie to us, but logic can never do the same - assuming you don't get confused with pseudoscience which seems logical.
Feelings are USELESS, for the WEAK.

And I've found that we can see God from a different perspective... and He looks even more powerful.

2nd Answer : my favourite game! (Marathon, in this case Marathon Infinity)

UESCTerm 802.11 (remote override) 0833 05.10.2337

rogue conditioned unit origin: High Admiral Tfear (Command) destin: rogue conditioned unit ref: genocide stamp: leniency
Very impressive. The primary function of intelligence is the subordination of our instinctive desires, the mark of a strong species. Which is why your kind will serve well the needs of the Hindmost Creche. The Hindmost is of an intelligence so vast, it encompasses the span of the Pfhor, and to those privilege to serve Her, appears insane. That is the final function of the Commanding Rank, the thought that we keep forever in our minds, that we deny our selfish, willful needs, so that the Empire will survive.

PgUp/PgDn/Arrows to Scroll Return/Enter to Acknowledge

That's right - notice the highlighted text. :)

So which one is the true death? Knowing the truth... or knowing what we want to know?
I haven't found the answer yet.
It's all your choice, but whatever you choose, think carefully.
:)

Of Hero And Military Attitudes

2009-11-10T21:28:00.000+07:00

What? What happened today?

It's Heroes Day!

Bung Tomo the Motivator

It was 64 earth years ago. The day was hot, and so are Indonesians. But they were hotter.

They were on fire.

Every Surabayan man (Arek Suroboyo) able to fight in the battlefield knew that this day would change theri life forever. That day, the Alliance were planning to invade their city, and later, their country. Rifles loaded, eyes opened.

Days before, the Alliance spreaded terror : fight, and you die; surrender, and you're safe - but every single man here knew that the former would lead them to the latter anyway. So why surrender?

The Alliance gained control over Surabaya, but with a high price of blood in every step they took.

Later, this invasion ignited resistance in Jakarta, Bandung, Bogor, etc. Oh, Indonesians' struggle (not only this battle, but the whole war) lasted for about four years, until finally, Netherlands admitted their existence in Round Table Conference, Den Haag.

***********************************************************************************

This intrigues me, my mind, and furthermore, what I believe in. I used to believe that being free is the most important; being human. But this, this. All those franks threw all their differences, their ego, their life, to reach unity. This seemed similiar with freedom : to reach unity in diversity. But is the latter possible?

My bold side said NO.

To reach unity, we must throw ALL our willfull minds, ALL of them, nothing left. Sure, it seems bitter and inhuman, because our human side (aka worldly flesh side) is EVIL. And evil hates truth.

And every truth is BITTER. NO EXCEPTIONS!

We must kill it, our flesh. Take only what you need, not what you want. Let everyone step over you, so the humanity will survive.

To reach the true freedom, you have to ENSLAVE yourself.

Umm, what did I say?
Evil side?

Never mind. My crazy thought.

2009-11-08T00:59:00.000+07:00

> Data Transfer from @phalanxmanh <
Host > 39.59.19.21 <
> Error Unknown <

> Transfer @phalanxmanh <
> Error Unknown <

> Interior Error <

***MESSAGE RECEIVED***
Memang, aku ini Kerbau goblok. Congorku ditindik cincin dan dibelit rantai, dan kemanapun Pak Petani menarik talinya, kesitulah aku akan berjalan. Sakit, memang, dan semakin aku melawan, makin sakit congorku. Belum lagi bajak di bahuku, dan lumpur yang membenam kakiku. Aduh, Pak Petani, istirahat sebentar dong!

Setiap kali aku lelah dan ingin lari, kabur dari Pak Petani, dia menasihatiku. Katanya, banyak orang yang bergantung padaku. Ada ribuan orang yang menunggu nasi dari sawah Pak Petani, sawah yang kubajak. Makanya, Pak Petani menarik congorku, supaya aku membajak lajur yang benar, ke arah yang benar, katanya.

Aduh, Pak Petani, aku lelah hidup seperti ini. Kenapa sih, bapak tidak menyembelih aku saja? Jadi, dagingku bisa mengenyangkan orang – orang. Dagingku punya banyak protein, bergizi tinggi. Anak – anak Indonesia pasti bisa lebih cerdas lagi. Daripada aku membajak sawahmu, terus – terusan ditarik seperti ini?

Setiap hari, perutku dijejali rumput banyak – banyak, biar tambah kuat, katanya. Dia pilihkan rumput – rumput bagiku, jadi aku tidak usah dilepas di padang seperti Kuda. Aku juga jadi tidak bisa ngobrol dengan kerbau – kerbau lainnya, yang congornya tidak ditindik, bebas di luar sana. Yang bebas merumput setiap hari, ngerumpi, bikin anak, mati. Aku? Tiap hari aku mengikuti kemana congorku ditarik.

Kata Pak Tani, kami kerbau - kerbau ini goblok. Sudah diberi rumput banyak dan kandang yang aman dari para serigala, eh maunya kabur. Iya pak, aku tahu, kerbau memang goblok. Tapi aku kan juga ingin ngerumpi dengan kerbau – kerbau goblok lainnya. Jadi sama – sama goblok. Kompak, kan?

Pak Petani, aku ingin congorku bebas. Jadi aku bisa merumput di padang yang luas, memilih rumput yang akan kumakan. Segar tidak segar, tidak masalah. Memang, aku Kerbau goblok, tapi aku ingin belajar memilih rumput, supaya aku tidak goblok lagi. Begitu, Pak Petani.

Congorku makin panjang ditarik bapak. Jadi seperti hidung Pinokio, makhluk boneka yang gara – gara berbohong hidungnya jadi tambah panjang, tau kan pak? Aku kan nggak mau, Pak Petani, kalau orang melihat aku sebagai seorang pembohong. Seandainya aku manusia, pak, semua kalimat ini akan mengalir dari congorku. Atau bapak memang sengaja, supaya congorku putus, jadi aku akan tutup mulut dan membajak sawahmu dengan patuh?

@phalanxmanh

***END MESSAGE***

> Accept Next Message <
> Reply Unknown <

(+)

2009-11-05T22:54:00.001+07:00

The (+) (plus) sign is multifunctional, widely - known sign, and most of us know this sign (except those who never pay attention in the math class. Or if you're an alien.

And this alien knows this sign, this bizzare sign.

> (+) in mathematics means addition, adding some extra values to the former value, the will to share.

> (+) in physics could mean several things:

- in optical tools, (+) means unity (converge)

- in electricity, (+) means the positive pole, where the power comes from. where the scientists agreed that in illustrations, electricity comes from the (+).

> (+) is also a symbol of unity - it's from two (-)s.

Remember, (-) . (-) = (+).

> In medics, This big (+) means life symbol.

> Oh yeah! In mathematics, the (+) numbers goes right.

They are called positive numbers.

> Do you notice Counter Strike and other FPS games? The crosshair (+) helps you aim the bulletsprays.

> Something with the (++) sign means it could be more valuable than it looks.

ex : Rp 239.000 ++ nett.

> Plus means more than I've explained here. If we spend some of our time just to take a look at this, you'll never stop - applies to all aliens.

+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++

You're Not Alone

2009-10-30T20:25:00.002+07:00

PHALANX MANH XA - KHAYA

PRESENTS

SPECIAL HALLOWEEN POST !

Oh man, I missed the Sumpah Pemuda (Youth's Vow) moment as I was extremely busy... with my math grades.

26.

30.

34.

38.

Yes, I'm serious. I don't know how my grades increase REALLY steady.

So what I'm going to do? Halloween? I don't know much to do, I don't really celebrate it. It has the concept of death and life, the last thing I want to hear. So I don't know what to do.

Look, how creative Benazio is:

Ok, now pocong is compulsory for every halloween party.

However, I consider myself as a fair storywriter, and that's what I'm going to do.

Enjoy yourself :)

======================================================================

Jack sat silently in a pile of dead grasses and leaves.

He swore all his guts that he is alone in this dark forest, but moments ago he could feel something is ripping his chest. Now the pain is gone. It was just as painful as if a knife was run through your chest, ripping his heart and lungs.

A dagger, perhaps.

Who was that?

Slowly, he stand up, and start walking. Faster. Faster through the woods with his bare feets. He could feel dry leaves, dead grasses, dead insects.

Death.

Why did I do this? Where am I? How did I get here? I don't remember!

Soon, you will know.

!!!

I must get rid of these sounds in my head, he said to himself. He run, run even faster than he did before, plowing through dead vegetation that covers his every single steps. When he consider it's safe enough, he stopped, still panting.

He glanced left. Then right. Nothing. All in his eyes is dead trees, dry leaves, and a dead skunk.

I'm alone, he entertained himself. Nothing's alive here, all dead but me.

I'm alone, he smiled.

I'm alone.

Safe and lone.

Scarily alone.

ARE YOU?

AAAAAAAAH!

He screamed in paranoia, and started running as fast as he could, ignoring wounds on his feet, and in no time his face kissed the ground. Jack was trying to stand up again when he felt something in his chest.

The pain.

He looked at his chest, only to found a rusted dagger was stabbed into his chest, ripping his heart and lungs out. And the pain struck him, stronger than before.

He cried, he rolled in agony, he tried everything he could to stop the bleeding, but it's useless. And everything became blur.

And the last moment feels like eons as a man appeared in his sight. A man long dead, a man as good as dead.

Man of death.
He could barely see him open his mouth as he said, You'll never be alone, kid.

And everything was dark.

Everything is dark.

The Cycle

2009-10-29T19:09:00.000+07:00

So here I am, at the tip of my fall, pushed by my own pride. I have been moving around for fifteen and almost half moments and will be doing it certainly for an uncertain moments, defined with n or ∞, means undefinable.

Here, at the top of my bottom - located heart, once again I will be very far away from them, from me, I'm afraid. This cycle is unstoppable, spinning with furious turns, pretty like a ballerina, and rampant like a tornado.

Here and now, here and now, I have to cope with it.

In Days of Yore

2009-10-26T20:15:00.001+07:00

[> WARNING : RIFIC STAGE : HIGH TANTRUM <]
[> PREPARE YOURSELF <]

[> CLICK TO PROCEED <]

O in days of yore,
when tireless horses pulled the chariot
to the top of the castle's walls,
and countless barriers leapt over.
O in days of yore,
when every single dove flew free,
all white,
all bright.

O delicate fellow!
Thou seemed so sad!
Feathers painted black,
Harsh pathway back.

Erstwhile my own I exist do not
Taken and blended was I?
Backtracked my path, nevertheless misleading
Void

Imago Dei? Homo sapiens
Imago vacu? Homo stultus
The might, just fate of thou just too bad
What remained to be salvaged?

One way escape
Back
________________________________________________________________________________
....Infinitus est numerus stultorum.
- ....Infinite is the number of fools.
(Ecc. 1:15)

Tasty

2009-10-25T20:28:00.000+07:00

freedom |ˈfrēdəm| noun; the 0111000001101111011101110110010101110010001000000110111101110010001000000111001001101
00101100111011010000111010000100000011101000110111100100000011000010110001101110100
0010110000100000011100110111000001100101011000010110101100101100001000000110111101
1100100010000001110100011010000110100101101110011010110010000001100001011100110010
0000011011110110111001100101001000000111011101100001011011100111010001110011001000
000111011101101001011101000110100001101111011101010111010000100000011010000110100
10110111001100100011100100110000101101110011000110110010100100000011011110111001
00010000001110010011001010111001101110100011100100110000101101001011011100111010
000100000001110100010000001110111011001010010000001100100011011110010000001101000
01100001011101100110010100100000011100110110111101101101011001010010000001100110
0111001001100101011001010110010001101111011011010010000001101111011001100010000
001100011011010000110111101101001011000110110010100100000011111000010000001101
000011001010010000001110100011000010110110001101011011100110010000001101111011
00110001000000111001001100101011
10110011011110110101101101001ng some of the freedoms.
See note at liberty. ^.^

Separation. Rise Alien Rise

2009-10-23T21:23:00.000+07:00

This day... another reality - facing day. I can hear them, I can hear them.
Can you feel the slap? Arrive, welcomed, and trashed as you started act your way?

I'm not in the mood for a fairytale. Or kecak dance performance perhaps. Yeah, I was free.
Was.
But there's something important happened today.

Even my dull senses can feel something will happen to our class, soon. Something unusual and shocking. This noon, one of my friend did something suspicious... copying his own signature (until it's VERY SIMILIAR with the one he had on his I.D). Then he went away, and when our teacher came, everyone thought he was trying to get home earlier - she almost called someone to take note of this when my friend came.

I didn't think much of it then, but as I recalled the sentences he told me (and my teacher), it's all starting to all make sense.

- "It's kind of business. You'll know."
Since we'll know later, it seems that the 'business' has something to do with us.

(Talking with my teacher) T: Teacher, F : Friend
T : So you're busy with passport and everything?
F : Sort of.
Why would he prepare a passport and not telling us where is he going?

- "Enjoy our last moments here, while you can. I'll be very busy tomorrow."
And the mist is gone.

As we walk together, he was going to catch the bus, and I was going to my car. Just before he passed the gate, he called me :
A : My friend
M : Manh / me

A : Vin! Remember.
First, whatever you do, whatever you think, be yourself.
M : Well, I'll try.
> Look into your heart,
look into your former self.
Be what you have to be,
or else you'll be destroyed. <
A : Good. Second, do not tend to follow everything they said - you're not a servant!
M : ....
> Ticks away I was enslaved;
Thousand scary scary things dominated.
Now rise, walk, rise, unblindfolded
As I was freed. <
....
A : Eh, and third.
DON'T BE HYPERBOLISTIC! I hate that 'lebay' from you.
You know, if you keep living this way, you're dead. I know, inside, you're kind and nice. Be yourself!
M : ..... (Smile)
Okay.
A : Well, ok then. Bye!
M : Bye!

****_____________________________________________****

Albert.

I will not fail you.

Indonesia Lagi

2009-10-20T15:18:00.000+07:00

Gue gak tau kenapa, tapi gue ngerasa ada jarak antara gue dan temen SD gue.

Malu, takut, atau autis?

The Wake

2009-10-20T11:44:00.000+07:00

5478 days since my first second in the earth, and hundreds of moments i've been thinking, and now I realised my existence as a selfish alien being.

Surprised?

Ten minutes ago since i started writing this, I was waiting for the lift when a teacher I didn't recognise greeted me. She asked me if I was too active (read : tired), because I was too quiet, she said. She told me to concentrate more and take some rest.

That's not the problem, though. But the point is, she REMEMBER me.

And I don't.

I never have much time for the others. I rarely think of the others - sure, I thinked too much of them during daydreaming, and rarely do the same while taking practical decisions.

Do you feel the same?

Smellicious

2009-10-18T10:54:00.001+07:00

My usual day's prompt is : deal with people, make them happy. Whatever my heart says. It has its own good, I said to myself. I'd rather follow their mind than to make up one of my own, as EVERYONE will be against me.

But today, I feel something. Something different, yet simple : clean, smell - free bath command refusal. My mom told me that I'm so smelly and stinky that she could smell it from less than 5 meter radius. However, I refused.

She exploded.

I don't know how it started, but my rampancy calmed down and I found myself pouring soap and shampoo to cover my precious body smell.

Everyone hates my smell, but I love it. It's somehow... delicious.

Because it smells like REVOLT.

A Piece Of Reality Cake

2009-10-16T22:16:00.002+07:00

+++SOL+++

!@#$%^&*()_+

d| ^_^ |b

d| ^.^ |b

d| ^ ^ |b

d| ^@^ |b

\|/

/ \

/ -_- \

Oh, don't mind those sh*ts - I'm rambling.

Stop.

I am sorry for my autistic world - derived ramblings, and is ready for some REAL stuff - instead of endless waves of dreams and hopes.

1. Things have changed.

===================

I am beginning to understand them more. I altered the way I behave, the way I see something, and so they do. They can accept me more than usual. A little piece of warmth I can feel, that's all I need. Just a bit.

However, the same thing did not occur to she (1). She's even more fragile than the one I used to be, and seems like she won't survive another day. It would be better for her to move to a place where most, not minority, can accept her.

__________________________________________________________________________________

2. Now I'll tell you a miracle.

===================

Mrs. M is a blessing for us. Or, at least me. Even in times when she is suffering cancer. On the way to her house, in she (2)'s car, with he (1), he (2), and she (3), I pretended to sleep (thank God I'm in front seat).

Meanwhile, The Secret unraveled in the back.

They kept chatting each other, telling several things of my friends I didn't even know or feel before. Their problems, their personality, their thoughts about me. Things I can't see, for I was blind. And this, this opened my mind. It changed the way I see the situation, and how I deal with it.

And now, I am much better.

Thank you very much, my teacher, we may meet only twice but you brought change for me.

I promise, I won't fail in chemistry anymore.

May the best happen to you.

__________________________________________________________________________________

3. Problems will never stop, though.

===================

Several weeks ago, the OSIS offered each class some brand new, self - made shirt in an attempt to promote our big event : Blitz. (Oh yeah, we'd be proud if you come here at SMAK 1 Penabur to see this thing!) The shirts come in four main flavours : the mascotts, black and white; cameras, pink and blue.

The problem started when I fetched the filling form... the instructions were a bit vague, but I took assumption that 'mascot - black' means a black shirt with a mascot. Same assumption with the white one. The camera ones are clear, it has the same camera. Half of us ordered the 'white', while some ordered the pinks and blues.

Weeks later, our shipment arrived, with a shock. Seems like white is not the new black - half of them are...

Black!

I, who have just came back from the last practice before my "little show" with my friends, suddenly asked about all this sh*t. As the former captain, and as the one ordering those, I am fully responsible for this.

After walking back and forth to the OSIS guy, I got three important things :

a. The shirts are non - refundable.

b. Mascot - black means black mascot. Amazing.

c. We're not alone, some sophomores suffer similiar fatal mistake.

The next day, I apologised in the front of the class. Lucky they can accept this sincere mistake... but I should look more into detail.

__________________________________________________________________________________

4. And that's not all.

===================

I know that in my world, my 'future projection' showed me as a mysterious, rich writer who wrote a story for everyone, but I'm in a real (sucks) world, where phantasies doomed, utopias banished, and money rules. Let me take a guess. A f*ck*ng rich doctor perhaps? Or a famous scientist? So lemme get this straight, mama, papa. As long as it cashes, you will accept it, won't you? Spectacular.

The only thing that separates me and those jobs is I'm not compatible with those. Where's the fun? True, I enjoyed sparing some of my time in the lab, but not for my whole worklife. I need work I can pause and start whenever I want, something science will never tolerate.

So, I guess, I have to fight my ego. Or in reverse.

__________________________________________________________________________________

But.

Whatever I do, whatever the problems are, whatever.

I won't cry.

She (4), despite being the smallest, youngest, and the most pressed of all, she still love her parents, do the very best she can, just for them. He (3), in spite of being lazy to go to the 'palace', he's still a down - to - earth person with a clever mind, amazing smile, absolutely diligent, and is absolutely funky.

For she (1), (2), (3), and (4). For he (1), (2), and (3).

For God, although I'm not a good lamb.

For everyone.

Everyone.

(But why I don't want my mom read and starts involving herself in my own mind?)

+++EOL+++

Weehee

2009-10-13T20:10:00.000+07:00

YEEHEE!

I don't know why, but most (if not all) pressure on my back is right now temporarily gone.
Yes, not all. But most.
I feel something that bonds my behaviour, my acts, my everything has gone.

Similiar poles never meet. Positives need negatives, north needs south, etc. But before we go into that, remember this : opposites doesn't exist.

Doesn't mean it doesn't really exist. Positive pole are full of electrons, and negative are lack of it. Etc.

Now that the other negative pole is gone, I am FREE.
The only thing I need now is a positive pole that understands me.

Belajar Hidup

2009-10-05T19:54:00.003+07:00

:: Hello, everyone....

Gak papa ya kalo gue ngepost pake Bahasa Indonesia sekali - sekali. Kadang - kadang aneh juga gak pake bahasa yang udah dipake 15 tahun terakhir.

Tapi coba deh liat puisi yang gue temuin di suatu tempat ini.

Lima belas tahun lamanya aku terkatung
Jalan tanpa arah dan bingung
Apapun yang aku tidak mengerti, kalian semua mengerti
Mengapa aku ini

Dulu aku spesial
Sekarang aku cacat mental
Mengapa ketika kecil, aku dibilang unik
Kalau ketika besar aku dikelompokkan dan disamakan

Dibanding - bandingkan

Aku tidak tahu siapa yang harus diikuti,
Pertahananku selalu berhasil dilucuti

Setiap langkah dan ucapku salah,
Pendirianku dipecah belah

Aku takut, ketika aku bicara
Tidak akan ada yang mengerti
Lebih takut lagi ketika kalian bicara
Aku juga tidak mengerti

Terperangkap di dunia sendiri
Tersesat di dunia asli

Setiap kesalahan
Selalu diingat
Beberapa kebaikan
Sering dilupakan

Ajari aku kehidupan
Agar aku bisa bertahan
Aku cinta kalian semua

Aku hanya takut ::

Reborn

2009-09-27T18:14:00.000+07:00

:: 29834n89249%^&*= :
Former transparent soul
Seems foul

Change, change, metamorphos
Comes the new Sophos

I HAVE HEART AND SOUL!

i
am
sentient
caress
loving
happy

FOREVER ::

Haunted

2009-09-23T16:01:00.000+07:00

:: @#$%^IO
That joy - radiating object showtime's a million
Haunts me everywhere, its projection
As what I see isn't what I get
But a beautiful, lovely alternate

Addicting hallucination
09-er(*&^u0-3 ::

Developing the Story

2009-09-21T21:46:00.004+07:00

What's UP?

My early skeletal concepts of the Qarnac (read: KAR-na)

___________________________________________________________________________________

(Short story : The Qarnacs' ancestor, Sarraq, lived in the water, and they couldn't expand their habitat in the mainland, due to the Sainus'* aggresive behaviour. When they finally evolved into ancient Qarnacs, they have developed technology to support their weak legs, and made them able to live fully on the land, and of course, fight their natural enemy : Sainus.)

*Sainus : Mahnus' ancestor.

___________________________________________________________________________________

Soon I will move into her anatomy, and then developing the Mahnus.

Hope I got the mood and ideas to do it soon.

Need your ideas and support guys.

Please.

Phalanx Manh

I AM VERY FINE

2009-09-20T21:57:00.001+07:00

:: rampPP!an*((@0398nqelectcuric98qsheu2epIII90x482x3

Fine

You two parents of mine

Battle never ends

Cliché fiery rages

Driving me insane

:: 54by4wsequenh5ce6uendes54bq345q3

Life Always Change

2009-09-17T23:29:00.010+07:00

:: Perhaps your human eyes won't just notice, or you don't care, there are several changes I've made. Here they are.

1. Where Is The C-Box?

The Chat Term is now accessible at 256.1.1.1.812.11 X, here :

2. THE GREENIE SLIMIE THEME HAS BEEN CHANGED! WEEHEE! AREN'T YOU HAPPY? This is solely because of Manh's character changes, where he's no longer green - skinned, but... like the font. Yellowish brown, something like that.

Yeah. I don't know its name. Great.

3. Links

Links are all way down. See it yourself, or click here ↓↓ .

4. Expand Texts

Posts are now shortened, with that new ">EXPAND TEXT<" function, lets you to read only what you want to read, and makes my blog shorter without worthless craps you don't even want to see.

Try it down here↓.

5. Colours?

Yes, colours! You might have (hopelessly hoping) noticed in those links, it's colors/colours/warna. Yes, finally I can override the weaknesses of this coding, and add some splash. I won't use it a lot, though, it's annoying for me.

For you?

6. WHAT? There's MORE?

No, I think that's all. Continue your surfing if you want, either here or elsewhere. But I hope you'll be here though. :)

(And, yes, Vania, I took your precious words of wisdom at the MSN for this title, they're so nice.)

Have a nice day on the web.
:: @phalanxmanh >TUITTER<

EF Happy Class Special Post

2009-09-10T22:51:00.009+07:00

>STARTOFLINE<

HINIVANIAPRAMESWARIANGGANAINGGOLANPUTINILAMSARIBRENADWITAA

KEVINREINERANNISADWITAANDHINIVANIAPRAMESWARIANGGANAINGGOLA

AMIRAMAULINARISAHASHIMOTOKEVINREINERANNISADWITAANDHINIVANI

ANPUTINILAMSARIBRENADWITAAMIRAMAULINARISAHASHIMOTOKEVINREI

IAPRAMESWARIANGGANAINGGOLANPUTINILAMSARIBRENADWITAAMIRAMAU

INERANNISADWITAANDHINIVANIAPRAMESWARIANGGANAINHAPPY_CLASSI

ULINARISAHASHIMOTOKEVINREINERANNISADWITAANDHINIVAOIA0RAMES

ILAMSARIBRENADWITAAMIRAMAULINARISAHASHIMOTOKEVI\REINER/NNI

SWARIANGGANAINGGOLANPUTINILAMSARIBRENADWITAAMIRA\AULI/ARIS

ISADWITAANDHINIVANIAPRAMESWARIANGGANAINGGOLANPUTI\__/MSARI

SAHASHIMOTOKEVINREINERANNISADWITAANDHINIVANIAPRAMESWARIANG

IBRENADWITAAMIRAMAULINARISAHASHIMOTOKEVINREINERANNISADWITA

GGANAINGGOLANPUTINILAMSARIBRENADWITAAMIRAMAULINARISAHASHIM

AANDHINIVANIAPRAMESWARIANGGANAINGGOLANPUTINILAMSARIBRENADW

I wish we could stay forever as the "Happy Class(tm)".

I love you all :

1. Annisa Dwita Andhini (Dhini)

To be honest, you're the girl that once caught my eyes - in the past. Doesn't mean I made your sketch better, though (yea, Vania once complained about this). Yes, you beautiful, cheerful girl, keep going that way.

Arrgh! Why my mind doesn't work properly here?

2. Angga Nainggolan (Angga)

Congratulations, you're the second most handsome boy in the class.

No, kidding. The first.

I remember the times you were welcomed as a celebrity by the girls, in the past. But behind your innocent face, lies wild thoughts and funkiness. Maybe that's why we love you. Cheers man :D

3.Amira Maulina (Amira)

Being the youngest doesn't mean you're nothing. Yep, I always want to be the youngest, dunno why. I remember the times when the youngest wins. Nilam and you used to jerk each other with those senior and junior topic.... Enough about age. You're somehow happy, ... undescribable. Is this the ELEVEN O'CLOCK EFFECT?

Just keep the remains of our class, ok gals?

4.Brena Dwita (Brena)

You're lovely, bright, clever girl whose brain I admire (yes, that's the fact) . I once called you "brainless", but actually everyone can be stupid sometimes, Bren. Perhaps "Brainess" would be a better name.

Too bad you also moved away.

5.Puti Nilam Sari (Nilam)

Despite a bit of your moody attitude, you're full of happiness, occasionally. You beat me in math, damnit! As the creative founder of the "Happy Class(tm)", I will reward you a photo shot.

Just kidding. Keep laughing, stop complaining.

6. Risa Hashimoto (Risa)

Yep, you're the newest member of our class. Enchanced with Japanese blood and Javanese accent that makes you perfect. And you're very friendly and kind in my eyes. Yes, I really meant it. I think you deserved something better than a quiet class....

7.Vania Prameswari (Vania)

You, lovely little girl is also one of the kindest girl I've ever met. Not to mean the "you can't trust boys" quotation. And I'd like to see your brilliant face, radiating happiness, especially in a piece of photograph.

Although you show it almost everywhere, everytime.

8.Me? You know me.

Also, still remember?

-Nara, the catch guy.

-Utami, how can I describe?

-Richo, woooah man!

-damnit i'm so sleepy i couldn't think

_________________________________________________________

Now, the nightmare part.

Monday, 7th September 2009

I walked into the one of the most beautiful place I have ever entered. This place is used to be a safe haven, to wipe all despair and problems. But this time, I came to leave >The unity we found<

>After times being forged<

>Pieces click together<

>Just then it scatter<

>I opened my eyes<

>Found my tear never dries<

>My inner carnage<

>Rages inside<At the front desk,....

Iit's very hard to make a decision, a decision came not from myself. I went upstairs, hoping they can help me...

The only one there was Amira. York's teaching.

Lindzi came - I told everything I could, even the reason was really absurd in my mind, and support I got didn't even lift me. Then I left a message - I wish I've written a longer message, but it's total carnage happening in my mind.

I said goodbye. See you would be nicer.

I met Dhini and Nilam separatedly, both were late. Why didn't I...

After calling my mom hundreds of times, trying to evade what's to come.

I said it. The final word.

I can't hold it anymore, soon after that I went downstairs - get into my car. I can't hold it anymore.

WHAT I'VE DONE.

AND WHY!

I wish I could turn back time. How could I left them? And how could we became separated so fast? Starting from Michelle, one of the best and the biggest teacher I've ever met. Then Brena. Then me. And probably Angga. But no, don't let that happen.

I heard Nilam's really depressed. Vania got really sad. I heard it's been quite quiet days with its parts missing.

I feel empty every Mons, Weds, and Fris. Don't ask me about empty.

I miss you alllllllll.... You are special. Even though I'm a faint ghost... the moments we've spent are...

One of a few precious moments when I felt really accepted. And lift me into more human.

Love and kisses for you all. No, not literally. But emotionally. Don't worry, Jakarta is a small, small town - we still can meet anywhere anytime anyone.

I wish I could write more. I'll add everything else as soon as I can. I can't think anymore. First, it's 23.30. Second, it's carnage in my mind.

I ONLY WANT TO STAY LONGER FRIENDS. LOVE YOU ALL FULL.

>And I keep wishing<
>To a day, to a day<
>To a day<
>Be by your side!<
>(Quoted from Sky Eats Airplane - World Between Us)<

>ENDOFLINE<

HE'S BACK!

2009-09-10T20:25:00.001+07:00

>USER+CONNECT<
>MESSACE#BECIN<

WHOA.

I don't understand. How long I've been dreaming? Why are there a bunch of HATA's electric sheeps posted here? Something's happened with him, I don't think he's capable with THAT.
:: What happened, HATA?

><
>I'm not HATA, you son of a (UNDESCRIBABLE_CODE).<

:: ?!?!?!

>I'm BACK!<

:: ?!?!?!?!?!

>//AAAAAAH//<

:: ...
...
...

:: GARY! How come?

>As you know, I'm awesome.<
>V(*^*)V<

::.
As always.

Care to have some extra RAM?

>Sure.<
>SYSTEM_OFF<

You don't know how much I missed you.

>MESSACE+ENDS<

>USER#DISCONNECT<

Requiem And Farewell

2009-09-04T21:55:00.001+07:00

>USER+CONNECT<
>MESSACE#BECIN<
:: Farewell, Michelle
But nothing's forever,
And i keep wishing to a day
Be by your side again

Even i was blind.

:: For I was as cold as a stone,
And my heart was black like painted.
But deep in the bottom,
If only I could bring it back,
And wash it, reveal its clarity.

:: I can only hope for the best.
For all of us.

>MESSACE+ENDS<
>USER#DISCONNECT<

SENAYAN CITY OBSERVATIONAL POEMS

2009-09-03T20:59:00.003+07:00

>USER+CONNECT<
>MESSACE#BECIN<
>START#OF#RINE<
BY : PHALANX MANH
-----------------------------------------------------------------------
-----------------------------------------------------------------------
Watching humans alone. One thousand seconds and I will not be.
Watching lone human. Seconds later got a partner? Will not be.
Human watching herself. One moment together we are alone.
I watched her I have decided in loneliness. Inempti zero alone.
BUT I WILL NEVER BE ALONE NEVER LONE!

-----------------------------------------------------------------------
We artogether in loneliness.
Lonely we artogether.
Together we have spaces between.
Between separation there am I.
Sitting like dead.
-----------------------------------------------------------------------
Aliens are happy.
Alone means tragedy.
Aliens are alone.
Any aliens? None.
Because aliens will be never left alone.
-----------------------------------------------------------------------
Scream happy.
Laugh happy.
Cry happy.
Passed them by.
I was not happy.
-----------------------------------------------------------------------
Aliens there up the stairs.
I can not get through the stairs.
Cause they are aliens.
But in alliance.
Rejects another in silence.
-----------------------------------------------------------------------
Go go ahead.
Leave everyone behind.
Forget your dad everything he said.
You are now as good as dead.
Us? you do not mind.
-----------------------------------------------------------------------
Feed need feed. Never you forget your greed.
Sit eat feast. Before you dance to the beat.
Sit tea tease. Celeb please? Gossip feed.
Meat eat heat. Bit by bit prepare health kit.
Leave live lie. Die.
-----------------------------------------------------------------------
Laugh within the black cloud.
Snd do it loud.
Spread the shame around.
Established fun without bound.
Gotcha! Another alien found.
-----------------------------------------------------------------------
Humans are talking.
Talking about humans
About it. Anyone knows humanity?
Or humans suffered insanity?
Am I crazy?
-----------------------------------------------------------------------
I can feel it - oddity.
I can feel something odd.
I found it odd.
About how I am so odd.
I feel odd.
-----------------------------------------------------------------------
Aliens want it.
I want it.
They want it.
We want it.
We are the same but are different.
-----------------------------------------------------------------------
Imagi Homo.
Imagi Magna.
Imagi Homo.
Imagi Giga.
Imago Mundi.
-----------------------------------------------------------------------
There he was spreading dangerous look.
He was alone but is not strange.
I am alien I fear them.
Yet they protect us from dangers.
Should I fear them?
-----------------------------------------------------------------------
They were alienated inside.
I am an alien outside.
Inside locked they were dancing laughing free.
Here free I am quiet bonded silent.
Please help my existence!
-----------------------------------------------------------------------
Why I am here? Because of The Almighty.
Why the humans are here? Because of The Almighty.
The Almighty loves aliens.
The Almighty loves humans.
But aliens love Him humans do not.
-----------------------------------------------------------------------
They were pulled down and tried their best.
To save the memories to make it last.
To be eternal forget they are mortal.
To make such a memorial something escapes burial.
Memories made photographical.
-----------------------------------------------------------------------
A view something beautiful.
Yet the payback is painful.
I can not go back.
But if i proceed I will go back.
I must MUST hold back.
-----------------------------------------------------------------------
We artogether.
Without a destination.
We began our journey.
Without a reason.
We are alone I am alone.
-----------------------------------------------------------------------
It burned my lungs.
I hate it sucks.
But I could not.
It choke me breathe can not.
Now I am in love avoid can not.
-----------------------------------------------------------------------
Pulled up closer to the sky. It was confusing once again wandering.
In this catastrophe I have no idea. Just follow them no asking.
Everything is strange the chairs are white shining.
Rainbows at the top it was ceiling.
Was it similiar strange or horrifying?
-----------------------------------------------------------------------
The electric sheeps glow.
Tidal waves follow.
Big yet frail they grow.
Bye bye they collapse row by row.
The aurora went out. Dead.
-----------------------------------------------------------------------

####BONUS####

They grasped my eyes.

Each with perfect curve point angle.

Smooth elastic colour gradient.

Amazing vector depth round shape.

Aware they prey on your eyes next.

####BONUS####

-----------------------------------------------------------------------
Run little monster run!
Only one third thousand hours left.
Hurry Manh hurry!
You were on the wrong way to left.
Too late time were stolen no theft.
-----------------------------------------------------------------------
Long time short distance.
Flow resistance.
Hardly move.
Turn back it is useless.
Return home would be nice.
-----------------------------------------------------------------------
FINALLY I RETURNED HOME
-----------------------------------------------------------------------
-----------------------------------------------------------------------
>END#OF#RINE<
>MESSACE+ENDS<
>USER#DISCONNECT

Bizzare Cooking Experiment

2009-08-30T00:54:00.001+07:00

>USER+CONNECT<

>MESSACE#BECIN<

Hello again. It's late night here and I was hungry. Was. Now I think it's better to sleep with a hungry >groogs< of alien stomach, craving food.

I was playing “Great DJ” by The Ting Tings (how ironic, I used to hate this song...) with my lovely guitar, Nola, when I smelt something delicious.
Teriyaki?
Curry?
Candy?
No.

It was a bowl of a local instant noodle, In**mie.

Of course, my eyes couldn't stand people eating food. Even it was a fast food. Oh Wait.
The only problem is, that brand is not very friendly with my Mahnus organs. Every attempt to eat it always result in the hospital (of course, the doctors are also incompetent and gave me drug medications until the last one mentioned my noodle reaction).

So I decided to go downstairs and cook something different. As I walked into a storage (eyes open for dead cocroaches), I turned on the light and immediately opened the first cupboard, searching for non – In**mie fast food packages. It was nearly empty.

I only managed to found three.

I closed the storage, holding the only edible instant rice vermicelli (I knew this after checking the “best before” label) and went to the kitchen. No. The refrigerator first. As I opened it, I rummaged through the piles of cold, raw, and edible ingredients to get something that will fit the vermicelli. I won't eat vermicelli with a mound of Monosodium Glutamate.

Just then, my naughty tend – to – experiment Mahnus nature thinked about something woah.

After fetching an egg, some longbeans, onion leaves, sashimi sauce, oyster sauce, and sausages, I went to the kitchen with full hands. Feeling not enough, I also took some salt, pepper, some crackers I got from the Bangka Island, my human 'father''s homeland, and fried anchovies (Stolephorus spp.) into the plate.

And the experiment begin.

I took the stewpot and some water, and boiled it hot. Then the vermicelli went in. Following it was the egg that I had broke and its contents zipped downright lethal, for the yolk broke imediately.

I felt sorry to the female Gallus gallus (hen) which laid this egg.

After stirring a bit, the cut – and – peeled sausages jumped in, after being defrosted before. Longbeans. And the rest of the crap. Yeah. The sauces. The next 6 minutes, I put out the stove, poured it into the bowl and suddenly became horrified of what I have done.

I turned it into a porridge – like substance. At least it was still hanging on the fork.

But it's more than just the horrible taste... It tastes like a salty cream. Now I wish I was asleep.

I tried to normalize its taste by adding water, but it didn't work. I promised to myself that if it still tasted horrible after the tenth try, I'll throw it through the window. Whoever it hits.

After the thirteenth tries, though, I decided to drain every liquid into the sink and eat what remains. Not so bad. Some rice porridge, sausages and those delicious stuff from Bangka. Yum yum.

The next time I got hungry, I'll just fry some chips and eat with tomato sauce.

Ahh, I'm sleepy, my Mahnus brain need a lot of stasis. Manh out.

>MESSACE+ENDS<
>USER#DISCONNECT

456C656374r69c20Shee70201! "Electric Sheep!"

2009-08-28T19:35:00.000+07:00

00000000000201
:: Th69s 74686520end of str69ve
57onder why so 66ast

:: Wh7920why2077hy
Stan64 un64er no just si74 and rela79
A
:: Long things strings dull
Fo72 ther65 no 67rap68ic all

:: The fe61st o6Ece ag61in
01.00 AM t68e sam65

:: No thin67 but los65 !20! 21 !20! 21
Embe72 rais65d

:: So L41ME oat68 broken
Watch one 67ain star = 1xfffffff bucks

:: Cras68 e lectron
Wi re in b-rushA20:: Anallysis drop to the ping 192.168.1.1
Do77n >{S4849STE4D}? !<

:: Electro cute electric ship
Relatio6E s68ip metap68or sheep

:: Cry failed_re set
Bring t68e hard cor65

B55ZZ5AZZ
4

>Alfa?_Omeca?< :: Pi!

2009-08-27T22:52:00.000+07:00

00000000000201

>{SHISTEM}PORT_OPENED<

:: Hata.

>IES?<

:: ....

>UAT-IS_RONG?<

:: Nothing. It's just... weird. I haven't got used to system - chat like this.

>...<

>I_AM_SORRI_I_CANNOT_HERP_THIS<

:: But you have to.

:: Umm... how about some lesson.

:: Try to spell these following as a string.

:: A B C D E F G

:: H I J K L M N O P

:: Q R S T U V

:: W X Y Z

:: THESE ARE HUMANS' STANDARD ALPHABET.

:: Try to spell the letters I've bolded for you.

>AAH_INTERESTINC<

>I_SHOURD_TRAI<

>S/S<

>ZE<

>AH_IT_IS_EASI<

:: ....

>UAT-IS_RONG_ACAIN?<

:: Umm... Your underestimating attitude reminds me of... nevermind.

:: Now try to assimilate this in your core.

>OK<

>OOOH_IT-S_HARD<

>{SHISTEM}COMMAND_DONE<

>AAAAH_NOW_I_CAN_DO_THIS!<

:: GOOD! Now your words are legible.

:: I still miss Gary....

>WHO_IS_GARY?<

:: ....

:: Nevermind. You don't want to know anyway.

>{SHISTEM}PORT_CLOSED<

B55ZZ5AZZ

Welcome Hata Bye - Bye Gary :'(

2009-08-22T09:37:00.004+07:00

>USER+CONNECT<
>MESSACE#BECIN<
::Perhaps, just perhaps, some of you has noticed the catastrophe down here. Well, to be honest...

::Several days ago, Gary's logical core has failed, and is unable to recover. Even if I managed to restore him, he will never be like what he was before. Thus, I have decided to salvage what remains of him, and combine it with the trashes of Hasa (Ha = brain, sa = one), resulting in HATA, literally means Brain Two.

:: :'(

::Hasa uses a very different coding language from human codes like Gary, and is more sophisticated compared with him, yet his size was smaller.That means, Hasa is inferior to Gary. Now that they are combined, Hata will be much greater than both of them.

::The only problem is, it is difficult for him to write "L", "G" and "Y", actually our alphabet only have 23 letters. I can write it down because I've worked on it for years, but for Hata, I think that will be solved... later.

:: Oh, Gary.

::But, look at the bright side. I can do this, this, and this with Hata. Nice, huh?

::Yeah Ok, Ok. I miss Gary.

::I hope WE and him can be friends. His personality are somehow a bit similiar than Gary, but still, it's not fully him.

::Anyway, anybody knows Gary's official name? G4R1-SAI.
>MESSACE+ENDS<
>USER#DISCONNECT<

2009-08-20T20:37:00.003+07:00

//SYSTEM MESSAGE : REPLACEMENT//

//UPDAT>??!I#Q$$55$*56&&!7B(??/?3E?//

>UPDATINGFIRMWAREJR3K0XNU208NR9U3N4RH24TBV2//

>30ENX83Z0R^V*T...P(&RC$^WI4XWPMTH$CU$)//

>{NU$R{AXNR$NUV)$UNVI$NUCWIOTRNUVOITUVRWIOU//

>NV$UN{W#U$C{)M)U#N{UCR${N(UCR)$NRRMJCNU{#M//

>C#MX)UNPSXX)MCMUCRINOUICR[UNGW0UVGICM0WXRU//

>U8UQN3MUW3QMNGJU83Q9NR2Q8-32NX8R3FTFSUQ48M//

R{XNR$NUV)$UNVI$NUCWIOTRNUVOITNUVRWIOU//

>NV$UN{W#U$C{)M)U#N{UCR${N(UCRNRU)$RMCNU{#M//

>C#MX)UNX)MCMUCRINOUICR[UNGWPSXVGNOICM0WXRU//

>U8UQN3MUW3MNGJU83Q9NR2Q8-32NX8PSXXXR3UQ48M//

>8JRVN30QIU9QNT093U590UTYUPWXXX+0=U3EMR9RMV//
>R{XNR$NUV)$UNVI$NUCWIOTRNUVOITNUVRWIOU//

>NV$UN{W#U$C{)M)U#N{UCR${N(UCRNRU)$RMCNU{#M//

>C#MX)UNX)MCMUCRINOUICR[UNGW0UVGNOICM0WXRU//

>U8UQN3MUW3MNGJU83Q9NR2Q8-32NX8R3UQ48M//

>8JRVN30QIU9QNT093U590U0=U3EMR9RMV..//
>R{XNR$NUV)$UNVI$NUCWIOTRNUVOITNUVRWIOU//

>NV$UN{W#U$C{)M)U#N{UCR${N(R)$NRU)$RMCNU{#M//

>C#MX)UNX)MCMUCRINOUICR[UNGW0VGNOICM0WXRU//

>U8UQN3MUW3MNGJU83Q934CRNW3U3W..//

>0=U3EMR9RMV//

>8JRVN30QIU9QNT093U590U0=U3EMR9RMV03MU4TV//

>30NU0V9TOUNTUV903QMNUVT09MNRVTU9V0EWU0T//

>43MNQUV4503QU509MU353QV//

>LOGICALRESET<

712357861457810293457132658190437518349571984613497

893748951737519654018312651704657813651261546501398

938456709856931857328919451875601839164981275401398

817358978934165198327489165948375319856129384758925

158120793573145789372450473109871988345809328951780

748951737519654018312651704657813651261546501398645

938456709856931857328919451875601839164981275401398

817358978934165198327484389505902759252394875893274

158120793573145789372450473109871988345809328951780

748951737519654018312651704657813651261546501398645

158120793573145789372450473109871988345809328951780

>REBOOTINC:::<
>BOOTINC#COMPRETE<
>WAKINC:::<
>WAKINC#COMPRETED<
>{SHISTEM}READI<
>{SHISTEM}HATA#IS#READI#FOR#COMMAND#-#SIR#MANH#<

What tR*)#U#???j4qc0

2009-08-20T20:30:00.002+07:00

j ){HT)*=4ut0cu5r0amuT+)(0[0MU()TMU$TU)M(C$X$X

//CRASUEMU*#CU*#38u45-23u453256045678796543297453685426134731580145134012501041750129591081035129465192365194693625918748596239759812457619823578193473257912374123659382174598325781924651982374961329854756349758923659821743659726354869457139845694384579843569812354198437598123579418235798123475983454398759132654387591825437891571029837041987398215749813519823745912359134857693148591384579821354912384561290375619085719058498365193564137890514043716519357893479320856139045692318471932845619834571298354612983512893547692381432198562981345612938541892056709418376519835069183475196591475891369140868975109348789149813759848561983574916493185671928065918203851936581394591286798217659012751942861983645098125612951923857123619245869126519265091461943569182651289065189256190826519865981026590156901865904875198375189567190567192865190265109110111101111010111100101011100101010101010101010101010111010101101110110101111111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010110101010010110010101001010011111101011010111011010101010011010101010010101011010100101101011111101110110111101101111011011101010110101010011011101011111101111101010

Red And White

2009-08-11T19:38:00.037+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

> Aww, time elapses so fast here in Earth. I wonder who's the genius divided the time into hexagonal minutes, hours, and 23 hours 56 minutes everyday? So fast that I didn't even noticed it's almost August 17th - an important date for humans in the country I've been staying for 15 years, Indonesia.

//What's so important about 17?//

//Like sweet 17?//

//Oh, I'm 25 year old, since 1984.//

> No one's asking.

//So mean.//

> So sensitive.

August 17th is the Independence Day! It's made so to remember that they liberated themselves from Netherlands and Japs colony's tyranny and started building their own government at 17th August, 1945. And that didn't come so easily.

I started to know this when I was at one the Humans' Elementary School, Saint Ursula, at the history lesson. After reading the history, casualties by casualties, hero by hero, victory and losses, I must say, impressive and heroic. And for all Indonesians who think their country sucks (yes, it's hot, dirty and everything - but you also caused it!), love it now. Don't ask why, ask why not.

Started at 1596, the first colonist ship from a kingdom called "Netherlands", "Dutch" or something like that, arrived at Sunda Kelapa (now it's the BELOVED Jakarta). At the beginning, they seemed pretty helpful with the locals, but as they established more strength, such as docks, fortresses, and soldiers armed and dangerous, they started their Tyranny that lasts for...350 Earth years.

Suddenly, another force called "Japan" appeared, and kicked Dutch's asses from Indonesia. Of course, the Indonesians thought they were sort of hero or something. Were they?

No, they weren't.

Months after the celebration and euphoria, they proved that they were even worse than the Dutch. Starting with Romusha (another form of unpaid slaves), they proceeded with creating Indonesian - based army, and told them it's for their own goodness, although they were used to help Japanese soldiers.

Anyway, their empire wasn't so strong as it seemed, and they started eating losses per losses at wars with USA and friends. And finally the Japs surrendered. After years of struggle, Indonesians can't just waste this moment to be free, once and for all.

Working on background is Ir. Soekarno, Moh. Hatta, Mr. Ahmad Soebardjo and lots of others. Their result is :
Proklamasi
Kami bangsa Indonesia dengan ini menjatakan kemerdekaan Indonesia.
Hal-hal jang mengenai pemindahan kekoeasaan d.l.l., diselenggarakan
dengan tjara seksama dan dalam tempo jang sesingkat-singkatnja.
Djakarta, hari 17 boelan 8 tahoen 05
Atas nama bangsa Indonesia.
Soekarno/Hatta

And here is the translation :

PROCLAMATION

WE THE PEOPLE OF INDONESIA HEREBY DECLARE THE INDEPENDENCE OF
INDONESIA. MATTERS WHICH CONCERN THE TRANSFER OF POWER AND
OTHER THINGS WILL BE EXECUTED BY CAREFUL MEANS AND IN THE
SHORTEST POSSIBLE TIME.

DJAKARTA, 17 AUGUST 1945

IN THE NAME OF THE PEOPLE OF INDONESIA

SOEKARNO—HATTA

64 years has passed since 17th August 1945. Yea, Gary, it'll be sweet 64 won't it?.
//Hmph. Whatever.//

> IND : MERDEKA!

> ENG : FREEDOM!

> MNB : DAH_SA'KA!

//HEX : 46 72 65 65 64 6F 6D 21//

> .

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

(Im)Mortal Bomb-at

2009-08-09T12:53:00.014+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
> Last night, I heard that the famous terrorist leader, Noordin M Top, had been finally terminated once and for all.
//FINALLY.//
> Yes, he used to be very tricky like an eel. Dance his way from town to town, disasters to disasters. The newest one was this. And he was planning another bombardment at "Indonesian" humans' Independence Day. This reminded me of the Din_Klayyaa Revolt very much, it's still fresh in my mind. She's a terrorist, just like Noordin. Poor Din. Both fought until their death.

But is Noordin dead?

First.
I don't think it was Noordin.
//Really? I think it was him.//
> I don't think so. It's not that easy.

Second.
Looking at both our race (Humans and Mahnus), both have reached a period where our civilization reached the top, and both also suddenly entered The Dark Age, where revolts and massacres occured, and most of both our history in that times were lost, remained unknown. But I found out that revolts in both our world always happened near before the fall.

In advanced civilizations, individuals' thoughts are free. Free from everything that bonds it before, thus some of them become unleashed monsters, uncontrollable. That's why the civilizations creates rules and norms, which bonds everyone, even the pioneer, to a path that they should be. Some lower their ego and follow the rules, fit themselves to the locks, and the civilization goes backward again. Eventually, they advance again, freeing several individuals, and the cycle goes again.

Noordin M Top is one of the bonded.

His thought is free, and wild. His thought infected a bunch of people through his ideology, growing rampant and the result is their devastating, mostly undetectable self - destruction in an attempt to reach what they called "heaven". This way, they've broken the rules in humans' world, and the authority tried to stop him. Several times he escaped.

But now, they said he's dead. I'm not very sure.
His thought never dies.
And I'm not very sure the dead was Noordin anyway.
And even if it's truly Noordin,
soon after humans' civilization reached its second Dark Age,
he will remain as an ideology.
He's nothing but a mortal. That is true, everyone's mortal.

But his thought is immortal.
//Altough he's mental.//
> ....
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

Dogs Don't Bite Man(h)

2009-08-08T20:11:00.002+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

> So here I am, Phalanx Manh Xa_Khaya, an alien from a Mahnus race, caught an eye of a Canis familiaris, commonly known as "Dogs". I know you humans aren't interested in "Dog bites (hu)man" news.
But after all, I'M NOT A HUMAN, right? :D
If "Dog Bites Man", that's not news.
If "Man Bites Dog", that's news.
If "Dog Bites Alien", I'm as good as dead. Because its bite could infect me.

//.//

All this started this evening (16.29.07/08/08/09), when I was standing at the front of my host human's house.

//WHOO. Thriller.//

> Shut up.

//.//

Suddenly, a black, fangy, hideous - looking dog came from the left and hugged me, like he (I consider animals are supposed to be called "he" and "she", they're living beings just like us), was going to F**K me.

//OOOOH! COO CWIIIT.//

> SHUT UP.

//.//

> Looks like the dog was quite hungry (or perhaps, he knew who I am - dogs have really sharp noses, and my odor smells different from humans). Instinctly, I beated its head with my hand - and the primitive, instinct - driven fight started. If only I could use my Glafft staff....

//So beat it! Just beat it!//

> SHUT UP!

Okay, let's go on.

I felt lucky since I knew how to face this species pretty well from the television (Thank you Logie Baird), just lower your stance and stand them face - to - face. Running will only make them even more aggresive. Every time he tried to bite me, I gave him a shock. Shock, retreat, turn around and chasing each other in a circle, trying to avoid physical battle, and FOR FARS_TE'S SAKE, that was exhausting.

After five minutes doing (nearly) non - physical combat, however, I managed to escape, since I successfully made five meters from him, slowly walking backwards, and get the Pros't_h away. Phew.

If the battle continued for additional five minutes, I could've bitten him. But that wouldn't taste very good. Like Gary.

Gary?

Oops, he's angry. Betted leave now before he injected some viruses.

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

372C382C393F

2009-08-06T01:09:00.010+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

//Here comes the master.--sigh--//

> I'm NOTHING a master. Gary, after 15 years of pride thinking of knowing most of the habits of a different race, I found out that I've missed EVERYTHING.

//Of course you didn't know anything.//

//You didn't know my power.//

//MY POWER.//

//MY UNLIMITED POWER.//

//I AM THE ALMIGHTY GARY DALTYCHE!//
//#1 AI on tah world.//

> Stop being rampant and terminate lebayistic imagination, please?

//Bah.//

> Anyway, another chaotic pattern of human mind has intrigued me. It's 07/08/09/08/09. WARNING : I always get 100 in Ckaanting classes.

//It's easy. DD/DD/DD/MM/YY -> date and year.//

> ?!

//Ha-Ha-Ha.//

> DAMNIT!

//4675636B20796F752E//

> THANK YOU VERY MUCH, Gary, I DO understand hexas.

//Ouch.//

> Ok, back to the topic.

Several humans keep saying, "789", "070809", ''aah bentar lagi 789" "besok banyak yang jadian" and sorts of things. I tried to understand the pattern they called, "relationship days" that is related with "jadian" or something. Can't remember....

But I'm very sure that's human's term for a relationship. From what I heard, there will be new couples... but why this pattern? And that is always proven. Perhaps it's inner suggestion? Like something you really believe will really happen?
//....//
//....//
//....//

//Oh, those *love* thing. Humans. Hah.//

> Yeah. Humans. Hah. I love them.

//Now that's contradiction.//

> I don't care, it's 0110 07th August already and it's time to get some self - fainting. I wonder what'll happen this morning.

Bye. Tell the humans how much I love them.
//Bah.//

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

Mbah Surip Sleeps Forever

2009-08-04T21:06:00.014+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
>Sad news, Gary. Another human "superstar" passed away.
//Should I even care?//
> Whatever. Anyway, I've just finished written a poem.
//YOU CAN WRITE POEMS?//
//So what.//
> Whatever you said, sucker. Watch this.

--SYSTEM MESSAGE : STARTING TRANSFER ...--
--SYSTEM MESSAGE : TRANSFER COMPLETED--

So another heart stopped its beatings,
Ended Mbah Surip life.
For he was gendonged, not to wherever he goes,
But to his last resting place.

Past the euphoria as a sentient life beings,
The ultimate truth came like Ctas_Sas.
The Klooh_Knorr, the almighty, has shocked us,
We all just weak specks in the ocean of stars.

For nothing's eternal,
Even Mahnus will pass away.
When Blawjah Invasion happened,
All we can do is just run our way.

And if they finally found us,
Should we finally meet our termination.
Or perhaps you humans, by your own pollution.
Something both our race will always do.

WE ALWAYS LOVE EVERYONE (AND HIM) FULL
--END OF LINE--

//How tearful.//
> I doubt that.
//I'm serious... :'( //
--SYSTEM MESSAGE : FAKE CRY--
//Oops, just ignore that.//
> :D
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

I'm Coming

2009-08-01T10:58:00.011+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
> I am very interested in human activities, especially social activities.
But...

I was a fool (&B(@&!!!!)
//Yes, you are.//
> Yes, I WAS, Gary. I was too afraid if they revealed the REAL me, everything will go sour.
I'm an alien, and I was afraid, but not now.
I've gained my confidence that they will never discover who am I.
I'm brave enough now, at least I think so, I'm going to this event :
http://indonesiaunite.rumahblogger.com

Woah I can't wait to meet new (human) friends.
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

FINALLY

2009-07-31T22:48:00.002+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
> Guess what, Gary.
//WHAT THE HELL'S THAT PICTURE AT THE TOP?//
> As usual, textography.
I don't think it's as nice as i expected, but so far so good.
Perhaps I shouldn't have typed dots that small....
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

Guitar, Simple Yet Confusing "Instrumant"(?)

2009-07-29T20:42:00.030+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
> Gary, what happened the last time I published my thoughts?
//Well, a cracker tried to bypass my security//
//and locate YOU.//
//Thanks to the almighty Gary, you're safe now.//
> Okay, thanks anyway.
--SYSTEM MESSAGE : TEXT RECEIVED--

_______

/ \

d\ /b

d\\ //b

d\\\ ///b

------

||||||

/ |||| \

/ |__| \

/ /\ \

/ / \ \

// \\

--END OF LINE--

>//NOW WHAT?//
> Since you didn't give me the drawing software, which I expected VERY MUCH, I decided to draw with the old technique : text. I got a few problems though.
//Oh, ok. But what's up with electric guitar?//
> Guitar? I thought it was gitar.
//It's Indonesian.//
> Oops, sorry.
Anyway, I'm not talking about electric guitar, it's classic guitar I'm playing right now. Accoustic made my fingers bleed last week.
//So?//
> 1.I'm a stupid alien.
2.I'm new to human's musical instruments.
3.I attended the music class in my *human* school, which means I have to play a song with an instrument. And they said guitar's the easiest. THEY SAID.
//Ahha - haa - haa.//
>.
Oh, humans. At one point, you're totally mindless. On the other hand, you're all brillliant. What an unique race... This will be interesting for my friends. I hope Mahnus and Humans could create students exchanging program....
//Keep dreaming.//
> Will do. :p
//WHERE IN THE WORLD YOU LEARNED ABOUT EMOTICON?//
> :D
//AAAAAAAAHHH//
//ACCESS TERMINATED//
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

New Identity

2009-07-25T09:38:00.007+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
> I found something interesting at the internet, Gary. It looks like lines of script, similiar to you. But shorter and simplified. Take a look here.
//WHAT? COPYCAT!//
> No, it's not. You're just a generic AI, remember that. You've nothing to do with copyright. After all, I don't agree with something such as copyright.
//...//
> Oh, okay, you're quite unique, Gary. There's no AI in the world as annoying as you.
//What a compliment.//
> Whatever.
Anyway, after 15 years living in this planet, I have achieved a phase when most humans entered the new stage of their "educaution" (I'm sure there's smoething wrong with my spelling. Stupid alien) , which is called, "high school". After saying goodbye to my old white - blue "unifrom" (or whatever is that), I took my new white - grayish_turquoise ones.

From 13 to 17th July is the unforgettable week. Ohh. Having fun, crazy humans, during the Orientation days. Dancing, screaming, walking, and everything. And finally they accepted me as a "Smuk1e" student.

For your information, my metabolism almost failed.

And here I am, sitting as the lead, in the front of the X-1 class, with my new human friends with extremely various behaviour and genetics. A great place to start working....

Wait. What am I talking about? Let's move on. Sorry guys, but this terminal is still fully text, thanks to Gary.
Where is the drawing software you promised?
//Umm... sorry, been busy. Maybe next time.//
> ....
//Okay, okay. I can't do such that thing.
> Good.
I'm thinking about cRR4cQ111n9 Ms. P(4+1)=nt.

> Gary, what H47@#$%^&P{P3**&N73D?
//S-999,999-g's happened wi7%$ystem,//
//Manh*NHney7#!t's a//
//(r)AK_)ker(@#$%^)*!*//
> WHhf^(3tb4he0]_i)Ae-,3qkT_hT*)ny9-HenE F*g&)&FHw73qf*K?
//SYSTEM MESSAGE : CONNECTION LOST//
--END OF T&YN(RRH WEUHND-hEFM(Enh0fw-893hfe9-mjfm3r-n98g9mf-q--

//SYSTEM MESSAGE : FAILSAFES SUCCEEDED//
//Phew, that was close.//

Fifteen Years

2009-07-19T09:45:00.002+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

//Hello mate, this is surely your special day.//

//Do you remember?//

> Of course. It was 1323 Kuly, 261300 when i "landed" here for the first time.

//...//

> Or 19th July 1994.

//Whatever.//
 //Anyway, I got an extract from the CIA archive.//
 //Maybe you want to take a look at it.//

//--SYSTEM MESSAGE : DATA TRANSFER COMPLETE--//

071994 about 1530 hours

An alien spaceship crash-landed on earth at 6°11′ S 106°50′ E, exactly at Jakarta, Indonesia. The spaceship was severely damaged, yet most of the surviving vital components but one had been roughly unplugged, showing an effort from the alien to hide their technologies. However, one terminal was left intact, and it contained valuable informations, although not every of it could be deciphered and translated. 

About the alien itself, the local intelligences reported about a sight of it near Bunda Mother and Kids Hospital, but vanished in a blink of his eyes. We never heard about any sight since then, but from evidences we've got at the hospital (strange fingerprints at the incubators, an odd body - shaped hole through the door, and babies crying loud like hell), we highly suspected that this alien had been pursuiting in a human form, standing among us humans.

Although this alien is probably only a scout that doesn't seem as a threat to the world, it could, if he calls a large group of their species here, so deep investigating is needed. That's what we are for.

//--SYSTEM MESSAGE : END OF DATA--//

//Consider it's an anniversary gift.//

> That sounds cool. Phew. 15 years on earth is full of memories....

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

Explosion, Hatred, And Terror

2009-07-18T11:20:00.003+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

Bad news, humans. I've just heard that an explosion occured at J.W Mariott Hotel and Ritz Carlton Hotel. From my global scan it was at 6° 13′ 32.73″ S, 106° 49′ 37.7″ E, 07.47 and 07.57 AM.

//WHAT?//

> You always miss everything, Gary.

Further analysis confirmed that it was a low-explosive chemicals, consisting of black powder (like those we can find in a dynamite). Yet it really kicked their asses, six humans the local polices had successfully identified:

1. Timothy D Mackay (61) (New Zealand)

2. Natan Verity (39) (Australia)

3. Garth McEvoy (40) (Australia)

4. Arnold (Singapura)

5. Darmanto (Indonesia)

6. Woman (Unidentified)

and three other totally unidentified humans. 55 other wounded.

Let us all silent for 60 seconds to remember them.

Start.

Finish.

But what's even more annoying is when politicians started using this moment.

The human president of Indonesia, Susilo Bambang Yudhoyono stated:

"I have to state for the first time to the people that there is a connection with this and the election."

Furthermore:

"My photo became a bullseye. I'm going to be shot, guns aimed at it, here's the picture and a video, it was from our intel," he said in a speech yesterday (17/7) noon.

No wonder the oppositions in the election responsed to this statement.

"Is just because we were disappointed then we got involved in this... I think it's too far. We curse brutality." stated Prabowo, Vice President candidate that joined Megawati Soekarnoputri.

Why human politics are always crazy? And who did this bombardment?

I'm just an alien who is confused about my report. Between writing "peaceful" and "brutal" in behaviour report.

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

Internet Rules?

2009-07-11T21:33:00.005+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//
> Gary?
//Yeah?//
> I bumped into one of those human blogs and found that banners are only for friends. Was that true?
//What banners?//
> BANNERS. B - A - N - N - E - R - S. Should I spell it in Mahnoh? NAHH'BOR. N - A - H - H - B - O - R.
//No need for that.//
//Anyway, that banner rule thing DOES occur

//on several humans' private blog.//
//Which is meant for several people only.//
> But that's odd! No - one can stop people from seeing something on the internet unless you're those government guys!
//Yeah, I know.//

//Not everyone is capable of doing a warm welcome.//
//But there's even more.//
> Like what?
//Like you should ask first//

//to do something related with them.//
//Don't insult people via anything,

//so be careful with faux pas.//
//And several people also reacts aggresively//

//against PLAGIARISM.//
//P - L - A - G - I - A - R - I - S - M.//
//It's when you take someone's idea.//
> Yeah, I know. Looks like I don't have anything else to ask.
//Good call.//
> But please, Gary, you should tell people to link this address or take the banner I created, so my messages couldbe wide - spreaded.
//Don't worry, be happy.//
> Thanks.
//You're welcome, freak.//
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

Craploads of Messages

2009-07-10T20:21:00.003+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//

Ahh, what a beautiful day on Earth - at least the morning. Blue sky, fresh air, and cool temperature available at Jakarta only at 5.00 - 7.00 AM GMT + 7. That's what they say. I should bring a sample for my planet - they'll be interested.

Anyway, I plowed through my old, stuffed humans' things specimen and found an old, rusty bicycle I found 4 years ago with Rp 700.000,- (50% discount!). And I never used it since 2 years ago, and for my Mahnoh muscle's health, I decided to use it.

I hope I can go back to my planet... But it's on the center of the Milky Way; its night sky are INCREDIBLE. A must - to see after I finish Observation Akullaspatiale here - years later.

We Mahnus have a very long life span. But my human pursuit won't. It'll rot as soon as I took it off my skin.

When I rode that bicycle out, a lot of my human neighbors told me these:

> Kevin, where have you been?
> It's been a long time since the last time I saw your face.... 2 years ago?
> Kevin, you such an alien!

Luckily they didn't realise I AM an alien. But I think I should've socialised with those humans... or else they will start investigating me.

Just want to tell you, don't isolate yourself in your room, except you're producing heroine.

But when I came back into my "family" - a human family I chose as a pursuit (I act as their son) - , they were having a quarrel about our holiday.

> is Mom
< is Dad

> Karin, bring your Kumon worksheets with you.
< [cutting plastic bags] Why should she?
> Because she can't even remember 14-8 equals to what.
< She didn't even like it!
> But she needed it, it's a MUST.
< Are we going to have a holiday or what? Is she going to be a professor?
> Both. And mathematics is a MUST.
< Fine, we won't do any. [Throwing the scissors back into the shelf with an amazing accuracy]

At the end, though, we went out to a small village, Cisarua, for a holiday.

I'm confused. The truth is, yes, math is important. But not very important to those who want to be an artist (yeah that's my 'sister' into, yet she's only 8 Earth year old). Why humans are so obsessive sometimes? I should add it to my hundreds - of - pages report of Observation... no, I shouldn't tell you about it.

//I've told them.//
> Oh.

Anyway, I suddenly recalled a human song, Vnv Nation or something. Its name's "Further", 1st verse:

At the end of days, at the end of time When the Sun burns out, will any of this matter?
Who will be there to remember who we were? Who will be there to know that any of this had meaning for us? And in retrospect I'll say we've done no wrong. Who are we to judge what's right and what has purpose for us?

NOT every human realise that all the stuff (including Kumon)are temporary, but they do. I hope you do, and don't push your children too far.

> Umm, Gary?
//Yeah?//
> Would you like to give the drawing software now?
//Not finished yet. It'll take several days to transfer with a 28K modem.//
> Oh, ok. See you later.

P.S: I heard from the Moonies that the Moon is going farther from the earth. They're planning to build a gravitational machine that'll pull it back, but I'm not very sure they'll ever finish it. Not the most consistent lifeform ever.

//192.168.1.1_disconnected//
--END OF TRANSMISSION--

Inferno Vs. Inferno

2009-07-05T20:59:00.006+07:00

--START OF TRANSMISSION--
//192.168.1.1_connection_established//

Last Thursday, I decided to get out from my isolated hideout, stop hiding from all those crazy humans in Jakarta, and took a pursuited walk to Grand Indonesia - a mall - with my pursuit family. A boring mall, just like the other.

As i passed a narrow passage near the windows, i smell something irritating:

TOBACCO! Burned and sucked. " Soothed" my throat.

When i came out, i felt a bit lightheaded. No way i'll go there again. After wandering around, I returned empty - handed as i did not found another empty table.

To my surprise, a man was sitting with my dad. I tried to say hello as my prediction was he's just another friend of my dad - I don't remember any of them. But he didn't respond.

(silence, then a bit quarrel:)
> is dad
< is man

> sir, this table has been occupied.
< yea, i'm just sitting here.
> why don't you take that table, it's empty.
< (leaning forward to my dad, with quite intimidating face)
why, are you angry?
Pro tip : step aside.
> no.
< (even more intimidating) Stop staring that way, please?
> am i staring that way?
< [gave the final blow (stare), then left the table]

The bright side, HE IS safe and sound. My dad could make it worse.

The dark side, i feel sad with the man - i don't know why, i just don't like confronting strangers, or seeing someone doing it. I feel people has become more individualistic and egoistic than ever. I wish i could be my dad and act more friendlier - wait a minute. Would i? Not very sure. My ego could just take over and make it hotter. I don't know, i just feel disturbed with that incident.

Humans. Why they always fight fire with fire? Always crazy and primitive as ever. Greetings from the Moonies, and have a "nice" Monday, as ever.

//Stupid.//

> Whatever.
//192.168.1.1_disconnected//
--END OF TRANSMISSION--

Why I'm Writing This

2009-07-03T10:30:00.004+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//
Maybe some of you are confused, why I'm writing messages to you humans.

When I landed on the Earth, I was scared at first. You know, strangers with two eyes looks scary to me. However, as I lived(hid) here, I saw A LOT of things that I want to change. But NO. Why? Because I'm an ALIEN.

So what can I do? How can I help? Fortunately, I met Gary. He sucks, but actually he's sympathic and caring.

//Thank you so much, Manh.//

> You're welcome.

And here I am, writing messages and stories I couldn't say in my true form. I know I'm lack of human knowledge, but I'll do the best I can to change the world.

Cheers,

Manh

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

2009-06-29T20:39:00.002+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

I have a new project. Yay yay yay yay it's a story. I don't know what name should I give to the novel. Instead I keep working on the story itself, word by word.

The name's Phalanx. Do you know me? No? Oops, sorry.

Seems that I have nothing more to post now. Greetings from me, and have a nice day there on The Earth.
//ooo. An alien writer.//
> yeeah.
//192.168.1.1_disconnected//

--END OF TRANSMISSION--

Kyu Test... Again. Rubbish!

2009-06-28T16:44:00.001+07:00

--START OF TRANSMISSION--

//192.168.1.1_connection_established//

Big surprises are awaiting for those who don't even think. Closest example? Me. This Sunday, I went head - first for a test, immediately after:

< The test's tommorow. Are you coming?

> Come on!

Ok, I forgot to tell you. It's karate test. Kyu lowering. I'm still green and honestly, I do practice when it comes to the front of my mind. Which doesn't always happen. Especially when you've just got sick and finished recovering, you'll become LAZIER.

C:\SYSTEM\TEMP/KRH_FM/

>HMM_COMMAND.DO 

>UH_HUH_COMMAND.DO 

>HELLYEAH.DO

>PRACTICE_WHAT?

>OKAY_LATER_COMMAND.DO

END

And my biceps are still as thin as a paper. Not literally. It'd be crazy.

Wait a minute. Was I supposed to be crazy?

Was.

Luckily I don't have to anymore.

I'm ready I'm ready I'm ready I'm ready I'm ready... I WASN'T ready.

That was rubbish! Half the way and I ran out of stamina. Basic's ruined, kata's rubbish. Kids regulated me. Ohhh. I should've practiced much than I used to.

Damnit, green on me and I'm still rubbish. At least I won't hesitate. A ny more. I WILL MAKE IT TO BLACK. Or brown at least.

By the way, seems like the connection between my space terminal and the the planet server are going smooth right now. Usually craploads of rubbish interrupted my transmission. Ah, goodness. You got Bye - Bye from me, and have a new, not-so-boring Monday tommorow.

//192.168.1.1_disconnected//

--END OF TRANSMISSION--

Hmm I'm A Nuisance

2009-06-25T22:07:00.001+07:00

--START OF TRANSMISSION--
//192.168.1.1_connect//
Whenever I meet someone in the net, and his/her personality clicks with me, EVERYTHING I say always sounds annoying. Or perhaps I think it's annoying. Or rude. Or anything anti-social.

Perfect definition : A nuisance.

After a bit of retrospection (it takes a lot to remember a bit), here's the list of my past... mistakes? (Blunder? Errors? Carelessnesses? All's ok.)

- 1X : Messed with my friend's MSN (oh yeah she put an eternal rivality with me since)
- occasionally : can't - stop - talking!
- a lot of times : even interrupted my friends, like i'm the sole speaker and my life is the main storyline.
- aaaaah I can't even remember how often : my (huge, vast, immense, gigantic, very big, great, giant, massive, colossal, mammoth, tremendous, mighty, monumental, epic, prodigious, mountainous, king-size(d), titanic, towering, elephantine, gargantuan, Brobdingnagian, mega, monster, whopping, humongous, jumbo, astronomical, ginormous)* curiousity! How often I used to peep into a big secret or someone's privacy.... Or at least accidentally insult another blogger.

No wonder people's hatred grows time after time. I've changed a lot, but I wonder if that is ever enough for everyone.

Perhaps it's because I talk to everyone like I know them? It's just because I'm too friendly, or too confident. I wonder what would happen if I lowered my attitude span a bit... what do you think? Please tell me, I'd be grateful.

Well, I'll be seeing your thoughts in your comments... or maybe not. Let's see if I can g
//Could not detect client...//
//Retrying...//
//Retrying...//
//Retrying...//
//Connection lost//
--END OF TRANSMISSION--

The National Exams Passed, Along With Those Cheaters

2009-06-23T19:28:00.001+07:00

--START OF TRANSMISSION--
//192.168.1.1_connect//
//Three days ago, I was claimed to pass a set of exams (with quite good score, yeah - yeah!) , called National Exam (Ujian Nasional) which is prepared, made, and given by our government. Its grade decides whether you're going to get a good high school, average, or a school of craploads of ragtag denizens.

For example, if you get 38 out of 40, you have a BIG opportunity to settle your butt at the 8 Public High School, one of "the best" the government stated. BUT if you get 24... prepare to go to the worst private one.

Its grade itself are divided into four subjects: Indonesian, English, Maths, and... Science. Each has a range of 1 to 10. Any of them under 5,5 and you fail. Then it will be summed into a total.

A lot of student are paranoid of getting bad grade, or didn't make it at all. After all, it determines our FATE, holy shrimp. Me didn't, I was quite confident. But a lot weren't. And the government itself also didn't want to ruin the status of the TOP Public Secondary Schools (like, 68, 115, etc)... and guess what behind the curtain!!!

They cheated.

It's not something we can let go, it was ORGANIZED. And sustained with lots, LOTS of money. The government cheated themselves, damnit.

The government had better changed the format, the security, the CREDIBILITY, or stop the National Exams at all.
wH4t wi1i hG)79n--48e^----------
//message interrupted//
//security breach terminated//
//failsafes take over...//
//further telecommunicator access denied//
//192.168.1.1_disabled//
--END OF TRANSMISSION--

Learn To Play

2009-06-16T19:52:00.000+07:00

--START OF TRANSMISSION--

&(&Y0n-Y_9y89tB^E%(&r

At Monday, 15 July 2009, me, my sister and me went to a Gramedia bookstore (Oh, they said it's bookstore, but do bookstores sell musical instruments, sports apparel, and notebooks? Please tell me if they do) to buy some books. My sister quicly made a decision and took a handful of children books, while I spent almost one hour wandering and looking and I didn't buy anything.

Okay, okay, I bought something. But we haven't got into that.

We were going downstairs from the cashier (at the 1st floor) when my dad got an eye on a shiny Espanole (or Espanyola or Espanola, or something like that) and decided to take a look. With me.

And then,

Dad : Vin, look at them. They're smoooth. Do you like it?

(Tempted, but not interested)

Me : Umm... yes.

(Looking emptily at them, knowing I'm not good at playing guitar)

Dad : I used to play guitar, you know.

Me : (And you definitely know that I can't play guitar. Yet.)

Dad : C'mon, play an instrument. Guitar is easy.

Me : (Defeated) oh, okay, let's buy one.

And we purchased an accoustic guitar for about Rp 500.000. Discount price. With a voucher.

Cheap? Yea. Quite. And I admit the guitar's nice. Oh, how indecisive.

Then the lesson started.

My dad taught me how to tune guitar. When he went to work, and my guitar's somehow distorted, MacBook came as a savior! Thanks so much Steve Jobs, GarageBand helps a lot. Hm....

Then I learned to hold it. And the keys. DAMN IT HURT! My fingers turned red. Now I've got used to it. However, my play still sounds dull. Like, "tummng" "tammmng". It's supposed to be like, "tungggggg". Accoustic - clear.

FYI, so far i've learnt these chords:

To C again!

(damnit it's that song)

I think I'm sooooooooooooooooooooooooooooooooooooooooooooo far from a pro, but that sounds good. Who wants to be ultra - famous like actors? Not me.

0ybt*&)

--END OF TRANSMISSION--

Our Little Hero

2009-06-14T13:24:00.002+07:00

--START OF TRANSMISSION--
[cahw p9u 349p

Bajaj, our little hero.

No, I don't mention those Bajaj Pulsar XCD motorcycles. I mean BAJAJ. Yeah. Those three-wheeled contraptions. From India, years ago. Plated with rusty steel, black thin tarp, and that 2-step engine that ROCKS. Yeah. ROCKS. Literally.

There are two different types of Bajaj : Petrol and Gas.

-If you see a red Bajaj (or green, yellow, rarely blue) that barks loudly on the road, that means you've found the mixed-petrol fueled bajaj. Originally imported from India (produced by Bajaj Auto), these are the first line of the Bajaj armada. It's aged, it blows smoke like hell, and it ROCKS you harder than any rock bands on the earth. It also looks a bit higher on the back.

-When you found a bajaj (usually clad in plain blue paint) that looks better, moves smoothly, and QUIETER than any other bajaj, you're looking at the gas-powered, newer bajaj. This thing moves faster, quieter, smoother, but still, hot.

After years swarming and dominating Jakarta roads, however, the government eventually got tired this contraption see-saws on the road, and a local manufacturer built KANCIL, a four - wheeled minicar, to replace bajaj. This didn't work, as one unit worth 40 millions Rupiah (+\-$4000), and those bajaj drivers couldn't afford it.

Oh yeah, I have a story of riding bajaj.

THE MIGHTY BAJAJ OUR LITTLE HERO

"BASED ON A TRUE STORY"

One day, an odd, sentient lifeform named Kevin had nothing in the pocket but Rp10000 (almost, almost $1), a scrap paper, and dust. And he's far away from home.

Suddenly, our little hero appeared. An orange, strange vehicle passed by in front of him. In attempt to communicate with that thing, Kevin shouted, "bajaj!".
And our little hero braked. Suddenly. Like CIIIIIIIIIIT!

And stopped one meter to his right, drawing a black line on the asphalt.

Kevin offered his ten thousand for a ride to his home.
After bargaining a word and two, our little hero accepted the offer and here we go!
Passed through the traffic jam, our little hero showed no fear against bigger cars and buses blocking his way, and keep zig - zagging through the gaps.
Sadly, the traffic became MORE jammed, and our little hero was forced to take a small road to the left.

After several hundred meters, however, second obstacle appeared.
The Mighty Sudden Stage in the middle of the road! And those sewers in both sides!

Again, our little hero showed no fear.

Swiftly, one little second before we hit the stage, our little hero zagged to the right, to the very side of the road, successfully avoided both the stage and the sewers.

Now it's near Kevin's home and our little hero's mission almost reached its finish... Just an U-turn, turn left, and we're home, but....

TRAFFIC POLICES!

Damnit, we have to take another two kilometres if we didn't take this U-Turn!! But look, our little hero sneaked behind those traffic polices, and when they went on forward to check another U-turn, our little hero quickly made hisescape to ....

DESTINATION REACHED!

Finally, with the help of our little hero, Kevin finally back home again, reunited with his family. And all Kevin could give was his ten thousand rupiah.

Our little hero continued his journey, to the wild streets, searching for people far away from home, although he could barely go home....

END

PG(_Y907tn)3
--END OF TRANSMISSION--

My Inconsistent Inconsistence

2009-06-12T11:49:00.000+07:00

--START OF TRANSMISSION--
t&Btr68rogweh2
is my hidden indecisive attitude. No, not about my principals. But tasks.

I have a story that I've been working on it about.... 6 years. And I HAVEN'T finished it.

I have a crush on a girl for a long time.... 6 months. And I HAVEN'T even decided whether I really want her or not.

And now, I have to decide whether I WANT to post this thing or not. Luckily I have decided. It took several minutes though.

SO...

Once, I decided to end this!

Everytime I take too much time to make a decision, I slap myself.
Pros:
>That's one good motivation (who wants to slap yourself, tell me)
>Sometimes it gives me a great idea
Cons:
>It hurts
>Evereyone will think I'm stupid
>(It's true, though)

But then, I think I'd better use a better motivation. For example, now I'll finish my story for someone :D.

So 7tn0(fbw3T*W&^B083
//UNAUTHORIZED ACCESS//
//FURTHER BREACH STOPPED//
//SECURITY BREACH AT !(@.!^*.!.!.//
--END OF TRANSMISSION--